KEGG   Rickettsia conorii: RC1347Help
Entry
RC1347            CDS       T00061                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rco  Rickettsia conorii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rco01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rco00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1249426..1250574)
Genome map
AA seq 382 aa AA seqDB search
MMYINYLKDLIGFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGS
NEPNICFVGHVDVVLAGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFI
KNNTDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKI
GRRGSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTN
IEVSNNTSNVIPASTEASFNIRFNNLHSAETLAKQVEEIIKQHCKEYKVDYKLEYSSSAE
SFIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINE
YTKISDLQKLYDVYYNFLMEIL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtacattaactacttaaaagatttgattggttttaagtctgtaactcctaagagc
gatggggctattgagtatattaatgatttgcttaaacagcacggctttaagaccgaaata
aaaatattcggtgattctaaaagtgagcaagtcactaatctttatgctgttttcggtagt
aatgagcctaatatttgctttgttggtcatgtagatgtagtgttggcaggcaatcatgag
ctttggcataatgcaagtccatttaaagttagccagcaagatggtaagatatatggcaga
ggtgcggtggatatgaaaggggctatagcgtgctttctagctgccagtttagattttata
aaaaataataccgattttaaaggttccattagtttcttacttactagtgatgaagaggga
aaagcaaagcatggtactaaagaaatgctgcaatatatttatgatcaaggatataagata
aattttgctattgtcggtgaacctacttgtgaaaaagaaataggcgatgcaattaagatt
ggtagaagaggaagtgttaactttaaattaaatatagaaggcttaagcgggcatgtagct
tatcctcataaagcaaataacccattgccttgcttaataataatattgaatgagttaaca
aatataaaacttgatgaaggtactgaattttttcaacgttcaaatcttgaagtaacgaat
atcgaggtcagtaataatacttcaaacgtaattccggcaagtacggaagcatctttcaat
atacgttttaataatttacatagtgcagaaactttagcaaaacaggtagaagaaattatt
aaacagcattgtaaagaatataaagtagattataagttagaatatagtagttctgctgaa
agttttattcagaaccctagcgataaaataaaagaatttgctaaagtagtagagcatacg
cttaaaataaagcctgaattctctacaagcggcggtacgtcggatgcaagattcgtcaaa
aattattgtccgttagtagagtttggtttattatccgaaacggcacataaaataaacgaa
tacacaaaaattagcgatttacaaaaattatatgatgtgtattataactttttgatggaa
atactttga

DBGET integrated database retrieval system