KEGG   Rhodobacter capsulatus: RCAP_rcc00014Help
Entry
RCAP_rcc00014     CDS       T01213                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rcp  Rhodobacter capsulatus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RCAP_rcc00014 (xylA)
   00051 Fructose and mannose metabolism
    RCAP_rcc00014 (xylA)
Enzymes [BR:rcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RCAP_rcc00014 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(16372..17673)
Genome map
AA seq 433 aa AA seqDB search
MTDFFKGIPQIRYEGPNSTNEFAFRHYNPTEVVMGKTMAEHLRFAIAWWHSFAWPGGDPF
GGQTFDRPWFGDTLDLAKLKADVAFEMFDILGAPFFCFHDADIRPEGRDFAENTRNLEVI
VDYIGEKMADSNTKLLWGTANLFSHRRFMSGAATNPDPEVFAWSAATVKTCMDATHKLGG
ANYVLWGGREGYETLLNTDLTREAEQAGRFLQMVVDYKHKIGFKGTILIEPKPQEPSKHQ
YDYDVATVYGFLKRFGLENEVKVNIEQGHAILAGHSFEHELALAASLGILGSIDMNRNDY
QSGWDTDQFPDSVPEMARAYYEVLKAGGFTTGGTNFDAKIRRQSIDPEDLILGHVGAMDV
CARALKAAAALLEDGGLEANRKARYAGWDTAEAKAMLGSDLASIEALVRAKGINPQPKSG
RQERLENLWNRFV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcttcaagggtattccgcaaatccgctatgaaggcccgaattcgaccaat
gaattcgccttccggcactacaaccccacggaagtggtgatgggcaagaccatggccgag
catctgcgctttgccatcgcctggtggcacagcttcgcctggccgggcggcgacccgttc
ggcggtcagacgtttgatcggccgtggtttggcgacacgcttgatctggcgaagctgaaa
gccgatgtcgccttcgagatgttcgacattctcggcgcgccgttcttctgcttccacgat
gccgacatccgccccgagggcagggatttcgcggaaaacacccgcaatctggaagtgatc
gtcgattacatcggcgagaagatggcggactcgaacaccaagcttctgtggggcacggcg
aatctcttcagccaccgccgcttcatgtcgggcgcggcgacgaaccccgatccggaggtc
tttgcctggtctgccgcgacggtgaagacctgcatggatgccacgcacaagcttggcggc
gccaactatgtgctttggggcggccgcgagggctatgaaacgcttctgaacaccgatctg
acccgcgaggcggaacaggccgggcgcttcctgcagatggtcgtcgactacaagcacaag
atcggcttcaagggcacgatcctgatcgagccgaaaccgcaggagccgtcgaagcaccaa
tatgactacgatgtggcgacggtttacggcttcctgaaacgcttcgggctggaaaacgag
gtcaaggtgaacatcgaacagggtcacgcgatcctggccgggcacagtttcgagcatgaa
ctggcgctggcggcttcgcttggcatccttggttcgattgacatgaaccgcaacgattac
caatcgggctgggacaccgaccagttcccggattcggttcccgagatggcgcgggcctat
tacgaagtgctgaaagcgggcggcttcaccaccggcggcaccaatttcgacgcgaagatc
cgccgtcagtcgatcgacccggaggatctgatcctcggccatgtcggcgcgatggatgtc
tgcgcccgggcgctgaaggcggcggcggcgcttttggaagatggcgggctcgaagccaat
cgcaaggcgcgttatgcgggttgggacacggccgaggcaaaggcgatgctcggctcggat
ctggcctcgatcgaggcgctggtgcgggcgaaaggcatcaacccgcagccgaaatccggg
cggcaggagcggctggaaaatctgtggaaccggttcgtctga

DBGET integrated database retrieval system