KEGG   Rhodobacter capsulatus: RCAP_rcc00125Help
Entry
RCAP_rcc00125     CDS       T01213                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00040  Pentose and glucuronate interconversions
rcp00052  Galactose metabolism
rcp00500  Starch and sucrose metabolism
rcp00520  Amino sugar and nucleotide sugar metabolism
rcp01100  Metabolic pathways
rcp01130  Biosynthesis of antibiotics
Module
rcp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RCAP_rcc00125 (galU)
   00052 Galactose metabolism
    RCAP_rcc00125 (galU)
   00500 Starch and sucrose metabolism
    RCAP_rcc00125 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    RCAP_rcc00125 (galU)
Enzymes [BR:rcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RCAP_rcc00125 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DUF3137
Motif
Other DBs
NCBI-ProteinID: ADE83890
UniProt: D5AKP8
Position
complement(131171..132064)
Genome map
AA seq 297 aa AA seqDB search
MKRKVTKAIFPVAGLGTRFLPATKSIPKEILTLVDRPLIQYAIDEARAAGIKEFIFVTSR
GKSALEDYFDDAPELETSLRKKGKTDLLEALKATNMDSGAIAYVRQNRPMGLGHAVWCAR
RLVGNEPFAVILTDDVIAAEKPCLQQMMEAYNETGGNVVAAMEVPHEKTSSYGVLDIAED
MGSLVKVKGMIEKPAPDVAPSNLAVIGRYILTPRVMQNLNKKKEGAGGEIQLTDAIAEEI
EAGQPVYGFRFRGQRYDCGSKAGFLQATVAFGLAREDLRDEFGDFLGDVMAMRTAAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaaggtcacgaaagcgatttttccggtcgctggcctcggcacacgcttcctt
ccggccaccaagtcgatcccgaaagagatcctgacgctggtcgaccgcccgctcattcaa
tatgcgatcgatgaagcccgggccgccgggatcaaggaattcatcttcgtcacctcgcgg
ggcaaatccgcgctggaggattatttcgacgatgcgccggagctggaaacctcgctgcgc
aagaagggcaagaccgatctgctcgaggcgctgaaagccacgaacatggattcgggcgcc
atcgcctatgtgcggcagaaccggccgatggggcttggccatgccgtctggtgtgcccgc
cgtctggtcggcaacgagccctttgccgtgatcctgaccgacgacgtcatcgccgcggaa
aagccctgtctgcagcagatgatggaagcctataacgagaccggcggcaacgtcgtcgcg
gcgatggaagtgccgcatgagaaaacctcgtcctatggcgttctggacatcgccgaggac
atgggctcgctggtcaaggtcaagggcatgatcgagaaacccgcccccgatgtggcgccc
tcgaacctcgccgtgatcgggcgctacatcctgacgccgcgggtgatgcagaacctgaac
aagaagaaagagggcgcgggcggggaaatccagctcaccgacgccatcgccgaagagatc
gaggccgggcagccggtttacggcttccgcttccgcggccagcgctatgactgcggctcc
aaggccgggttcctgcaggcgacggtggcctttggtctggcccgcgaggatctgcgcgac
gaattcggcgatttcctcggcgatgtgatggcgatgcggacggcggcgcagtaa

DBGET integrated database retrieval system