KEGG   Rhodobacter capsulatus: RCAP_rcc00136Help
Entry
RCAP_rcc00136     CDS       T01213                                 

Gene name
phoA
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RCAP_rcc00136 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RCAP_rcc00136 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RCAP_rcc00136 (phoA)
Enzymes [BR:rcp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RCAP_rcc00136 (phoA)
Exosome [BR:rcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCAP_rcc00136 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
143850..145343
Genome map
AA seq 497 aa AA seqDB search
MTRLLLSTALCLASSVAVLAGDLPQAQSDWFKAGQAKIAERMTVAPITKPAKNVILFTAD
GNGVGTNYAIRLFSGQQAGGLGDDYVQPQETFPHVALVKTYSSNGQTPDSAPTAAAMNSG
IKTKNGMINVLDTVNVGDCAAGATAGTKTFAEIVSDMGKSVGVLSTARITHATPAAVYAR
TVDRDWEDPSKMPEGCTQKDIAAQLIDQIKAGVIDVAMGGGRAHFLPKDVKDVEGKDGKR
PDGRDLVAEAKALGAEVVFGEEDFTALDLSGKAPVLGLFESSHMKYETDRTGEPSLAEMT
EAAIKALSTNENGFYLNIEGGRVDHANHDGNLYRTVTDGKAFADAIAVAMKMTNPEETLI
IVTADHEHAISFNGYCGRGSNVLGLCMEENEQGVTHTGKPNLADDGKPYTVAGYLNGVGS
VLVKQADGSFSGARPEVTEEQATDKDYIQQALVPMQSETHSGEDVAVYARGPWAHLFGGV
IEQNVIFHVMNHAVKPE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtcttcttctttccaccgcgctttgccttgccagctcggtcgccgttctggcc
ggggatctgccgcaggcgcaaagcgactggttcaaggccgggcaagccaagatcgccgag
cgcatgacggtggcgccgatcaccaagcccgcgaagaacgtgatcctgttcaccgccgac
ggcaatggcgtgggcacgaactatgcgatccggctgttctcgggccaacaggccgggggt
ctgggcgacgattacgtgcagccgcaggaaacctttccgcatgtggcgctggtgaagacc
tattcctcgaacggccagaccccggattcggcaccgacggcggcggcgatgaattcgggg
atcaagacgaagaacggcatgatcaacgtgctggacaccgtcaatgtcggcgattgcgcc
gcgggggcgacggcgggcacgaagacctttgccgagatcgtgtcggacatgggcaagtcg
gtcggcgttctgtccaccgcgcgcatcacccatgcgacgcccgcggcggtctatgcccgc
accgtcgaccgcgattgggaagatccctcgaagatgcccgagggctgcacgcaaaaggac
atcgccgcccagctgatcgaccagatcaaggccggggtgatcgacgtggcgatgggcggc
ggccgggcgcatttcctgcccaaggacgtcaaggatgtcgagggcaaggacggcaagcgc
cccgatggccgcgatctggtcgccgaggccaaggcgctgggcgccgaagtggtgttcggc
gaggaggacttcaccgcgctcgatctgagcggcaaggccccggtgctgggtctttttgaa
tcgagccacatgaaatacgagaccgaccgcaccggcgagccctcgctggcggaaatgacc
gaggccgcgatcaaggcgctctcgacgaacgagaacggcttttatctgaacatcgagggc
ggccgggtcgaccatgccaaccatgacggcaacctttaccgcaccgtcaccgacggcaag
gctttcgccgatgcgatcgccgtggcgatgaagatgacgaacccggaagagacgctgatc
atcgtcaccgccgaccatgaacatgcgatcagcttcaacggctattgcggccgcggctcg
aacgtccttggcctgtgcatggaggaaaacgagcagggcgtgacccataccggcaagccc
aatctggccgatgacggcaagccctataccgtggcgggctatctgaacggcgtcggctcg
gtgctggtgaaacaggccgacggcagcttctcgggcgcgcggcccgaggtgaccgaggaa
caggcgaccgacaaggattacattcagcaggctttggtgccgatgcagtccgaaactcat
tccggcgaggatgtggcggtctatgcccgtggcccctgggcgcatctcttcggcggcgtg
atcgagcagaacgtgatcttccacgtgatgaaccacgccgtgaagcccgagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system