KEGG   Rhodobacter capsulatus: RCAP_rcc00400Help
Entry
RCAP_rcc00400     CDS       T01213                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rcp  Rhodobacter capsulatus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RCAP_rcc00400 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RCAP_rcc00400 (pyrB)
Enzymes [BR:rcp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RCAP_rcc00400 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(429026..429991)
Genome map
AA seq 321 aa AA seqDB search
MAFRARHLLGIEHLSPEDIRSVLDLADSYVDLNRRTVKRTDALAGLTQINMFFENSTRTQ
SSFELAGKRLGADVMNMSMQTSSVKKGETLIDTALTLNAMHPDLLVVRHPSSGAVDLLAQ
KVNCAVINAGDGRHEHPTQALLDALTIRRAKGRIQRLTVAICGDVAHSRVARSNLLLLGK
MENRVRLVGPPTLMPAGFGDIGAEICDDMREGLRDADVVMMLRLQKERMDGGFIPSEREY
FHRYGLDAEKLAYAKPDAIVMHPGPMNRGVEIDGTIADDINRSVIQEQVEMGVAVRMAVM
DLLAQNLRAERGRAALEAAHV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcgcgcccgccatcttctggggatcgagcatctctcgccggaagacatccgt
tccgttcttgatcttgcagacagctatgtcgatctgaaccgccgcaccgtgaagcgcacc
gatgcgctggcggggctgacgcagatcaacatgttcttcgagaattcgacgcggacgcaa
tccagtttcgagctggccggaaaacggctgggcgccgacgtgatgaacatgtcgatgcag
acctcgtcggtgaaaaagggcgagaccctgatcgacaccgcgctgacgctgaacgcgatg
catcccgatctgctggtggtgcggcatccctcctccggcgccgtcgatcttctggcgcag
aaggtgaattgtgctgtgatcaatgcgggcgacgggaggcacgaacacccgacgcaggcg
cttttggatgccttgacgatccggcgtgccaagggccggatccagcggctgacggtggcg
atttgcggcgatgtcgcgcacagccgggtggcgcgctcgaacctgctgttgctcggcaag
atggaaaaccgggtgcggctggtcgggccgccgacgctgatgcccgcgggctttggcgat
atcggcgcggaaatctgcgacgacatgcgcgaagggctgcgcgatgccgatgtggtgatg
atgctgcggctgcaaaaggagcggatggacggcggtttcatcccgtccgagcgcgaatat
ttccaccgctacgggctcgatgcggaaaagctcgcctatgcgaaacccgatgcgatcgtg
atgcaccccgggccgatgaaccgcggcgtggagatcgacggcacgatcgccgatgacatc
aaccgctcggtgattcaggagcaggtcgagatgggcgtcgcggtgcggatggcggtgatg
gatcttctggcgcagaacctgcgcgccgaacgcggccgcgccgcgctggaggcggcacat
gtctga

DBGET integrated database retrieval system