KEGG   Rhodobacter capsulatus: RCAP_rcc00445Help
Entry
RCAP_rcc00445     CDS       T01213                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rcp  Rhodobacter capsulatus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rcp00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477835..479154
Genome map
AA seq 439 aa AA seqDB search
MDARSIIMAVRDGAGLSPEAALWFARGLADGTVSDAQAGAFAMAVLCRGIGPGGRVALTQ
AMRDSGQVVRWDLPGPVVDKHSTGGIGDSVSLLLAPALAACGVYVPMISGRGLGHTGGTL
DKMESIPGYKSLPGVAVLRKVVAEVGCAIIGATEEIAPADKRLYGIRDISGTVESIDLIT
ASILSKKLAVGLDALVLDVKVGSGAFMATVEDAQALAESLVKTANDAGVRTSALMTDMNQ
SLGQSAGNALEVLEVMETLTGTSVNEALWDVTSALGGEVLMLAGKAASLDDGAARIDAAI
ESGRAAEIFGRMVAALGGPVDFVERYPDRLPAAPLIVPVPAPRAGFVARVNGRALGEAVV
RLGGGRLVGSDRINPSVGLTGQAMIGAEMARGEALALIHAPDQARADQAVAAVLAAYQMS
EDPPEEPPLIHCRIGPEEV
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggatgcccgctcgatcatcatggcggtgcgggacggcgccgggctgtcgcccgaggcg
gccctctggttcgcgcgcggtctggccgatggcacggtgtccgacgcgcaggccggggca
ttcgcgatggcggttctgtgccgcggcatcgggcccggcggtcgggtggcgctgacgcag
gcgatgcgggattcggggcaggtggtgcgctgggatctgcccggcccggtcgtcgacaag
cattcgacgggcggcatcggcgattccgtgtccctgcttctggccccggcgctggcggcc
tgtggcgtctatgtgccgatgatttccgggcgcggtctgggccataccggcggcacgctg
gacaagatggagtccatccccggctacaagtcgctgcccggcgtcgcggtgctgcgcaag
gtcgtggccgaggtcggctgcgccatcatcggcgcgaccgaggaaatcgccccggccgac
aagcggctttacggcatccgcgacatctcgggcacggtcgaaagcatcgatctgatcacc
gcctcgatcctgtcgaagaaactggcggtcgggcttgatgcgctggtgctcgatgtcaag
gtcggctcgggtgccttcatggcgacggtggaagacgcgcaggcgctggccgaaagtctg
gtgaagacggcgaatgatgcgggggtccggacctcggccttgatgaccgacatgaaccag
agcctggggcaatcggcgggcaatgcgcttgaagtgctcgaggtgatggagacgctgacc
ggcacctcggtcaacgaggcgctttgggatgtgacctcggccttgggcggcgaggtgctg
atgctggcgggcaaggcggcaagtctggacgatggcgccgcgcggatcgatgcggcgatc
gaaagcggccgcgccgccgagatcttcgggcggatggtggcagccttgggcgggccggtc
gatttcgtcgaacgctaccccgaccggcttccggccgcgccgctgatcgtgccggtgccc
gcgccgcgggcgggctttgtcgcccgggtgaacgggcgggccctgggcgaggcggtggtg
cggctgggcggcgggcggctggtcggttcggaccggatcaacccctcggtcgggctgacc
gggcaggcgatgatcggcgcggaaatggcccgcggcgaggcgctggcgctgatccatgcc
cccgatcaggcccgcgccgatcaggcggtggcggcggttctggcagcctatcagatgtcg
gaggatccgcccgaggaaccgccgctgatccattgccggatcggaccggaggaggtgtga

DBGET integrated database retrieval system