KEGG   Rhodobacter capsulatus: RCAP_rcc00564Help
Entry
RCAP_rcc00564     CDS       T01213                                 

Gene name
modC1
Definition
(GenBank) molybdenum ABC transporter, ATP-binding protein ModC-1
  KO
K02017  molybdate transport system ATP-binding protein [EC:3.6.3.29]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp02010  ABC transporters
Module
rcp_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RCAP_rcc00564 (modC1)
Enzymes [BR:rcp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.29  molybdate-transporting ATPase
     RCAP_rcc00564 (modC1)
Transporters [BR:rcp02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189] [OT]
    RCAP_rcc00564 (modC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE AAA_23 AAA_21 SMC_N AAA_22 AAA_16 AAA_29 AAA_25 SbcCD_C AAA AAA_30 Rad17 RsgA_GTPase TOBE_3
Motif
Other DBs
NCBI-ProteinID: ADE84329
UniProt: D5ANH5
Position
602736..603827
Genome map
AA seq 363 aa AA seqDB search
MISARFSGRQGDFTLDAAFDVPGQGVTALFGPSGCGKTTVLRCMAGLTRLPGGHLVVNGV
TWQEGRQITPPHRRAVGYVFQEASLFTHLSVRENLVYGLRRARGPLRISEAEVTQLLGID
PLLRRPTATLSGGERQRVAIGRALLSQPELLLMDEPLSALDRISRDEILPYLERLHASLQ
MPVILVSHDLSEVERLADTLVLMEAGRVRAAGPIAAMQADPNLPLIHRPDLAAVIEGVVI
ALDPAYGLSTLQVPGGRIVVPGNLGPIGARRRLRVPATDVSLGRHAPTDTTILNALPAVI
LGAEAAEGYQITVRLALGASGEGASLLARVSRKSFDLLGFQPGEQVVARLKAMALSAPAQ
TGG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgatctcggcgcggttctctggccgtcagggcgatttcacccttgatgcggcctttgac
gtgccggggcagggggtgacggcgcttttcggtccctcgggctgcggcaagacgacggtg
ctgcgctgcatggccgggctgacgcggctgccgggcgggcatctggtggtgaatggcgtg
acctggcaggaggggcggcagatcaccccgccgcatcgccgcgcggtgggctatgtgttt
caggaagcaagccttttcacccatctttcggtgcgcgaaaacctggtctacgggttgaga
cgtgcccgcggtccgctgcggatttccgaagccgaggtgacccagcttctgggcatcgac
ccgctgctgcgccgccccaccgcgacgctctccgggggggaacggcagcgcgtcgccatc
ggccgggcgctgctgtcgcagccggaactgctcttgatggacgagccgctttccgcgctg
gaccggatctcgcgtgacgagatcctgccctatctcgaacggctgcatgcgagtttgcag
atgccggtgatccttgtcagccacgatctgtccgaggtcgagcgcctggccgatacgctg
gtcttgatggaggcgggccgggtccgcgccgccgggccgatcgccgcgatgcaggccgac
ccgaacctgccgctcatccaccgccccgatctggcggcggtgatcgagggggtggtgatc
gcccttgatcccgcctatgggctgagcacgctgcaggtgccgggcgggcggatcgtcgtg
ccgggcaacctgggtccgatcggcgcgcggcggcggctgcgcgtgcctgcgaccgatgtc
agcctgggccgtcatgcccccaccgacaccacgattctgaacgccctgcccgcggtgatc
cttggcgccgaggccgccgagggctatcagatcaccgtgcgactggcgctgggcgcatcg
ggcgagggcgcgagccttctcgcccgcgtttcgcgcaagtcctttgacttgctcgggttt
cagcccggggaacaggtggtggcgcggctcaaggcgatggcgctgagcgcgcctgcgcaa
accggagggtag

DBGET integrated database retrieval system