KEGG   Rhodobacter capsulatus: RCAP_rcc00565Help
Entry
RCAP_rcc00565     CDS       T01213                                 

Gene name
modD
Definition
(GenBank) molybdenum utilization protein ModD
  KO
K03813  
molybdenum transport protein [EC:2.4.2.-]
Organism
rcp  Rhodobacter capsulatus
Brite
Enzymes [BR:rcp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     RCAP_rcc00565 (modD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
603831..604670
Genome map
AA seq 279 aa AA seqDB search
MFLIDDTALMALIREDVPAGDLTTRSLGLAAEAGELTMRARGAMTVACSEEAVRILQLLG
AEAWIATASGRQVEGGEMLLFARGQVEALLAGWKVAQNLIEWASGLASSATAIVAAARAV
NPAVTVACTRKSVPGTRALSLRAVTVGGATVHRTGLSDSVLLFAEHRAFGGADALAAQIA
RLRASCPERKVVVEVADVAEALAAAQAGAEVLQLEKFPPEQVAAVVAGLGPDWRGHVAAA
GGITAANAAAYAAAGAQVLVTSAPFTAPPRDVAVWIGPA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgatcgacgacaccgcgctgatggcgctcattcgcgaagacgtgcccgcgggc
gatctgacgacgcgcagtctggggctggccgccgaggcgggcgagctgacgatgcgggcg
cgcggggcgatgaccgtcgcctgttccgaagaagccgtgcggatcttgcagcttctgggc
gccgaggcctggatcgccaccgcctcggggcggcaggtcgagggcggcgagatgctgctt
ttcgcccgcggacaggtcgaggcgctgctggcgggctggaaagtggcgcagaatctgatc
gaatgggcttcggggctggcgtcctcggccacggcgatcgtcgcggcggcgcgggcggtg
aacccggcggtgacggtggcctgcacccggaaatcggtgccgggcacccgggcgctgtcc
ttgcgggcggtgactgtgggcggtgcaacggtgcaccggaccgggctttcggattcggtt
ctgctttttgccgaacatcgcgcctttgggggcgcggatgccttggcggcgcagatcgcc
cggctgcgcgccagctgccccgagcgcaaggtggtggtggaagtggccgatgttgccgag
gccttggcggccgcacaggccggggccgaggtgctgcagctggaaaaattcccgcccgag
caggtggcggcggtcgtggccgggctgggccccgactggcgcggccatgttgcggcggcg
gggggcatcaccgcggccaatgccgcggcctatgcggcggcgggggcgcaggttctggtg
acctcggcccccttcaccgcgccgccgcgcgatgtcgccgtctggatcggcccggcctga

DBGET integrated database retrieval system