KEGG   Rhodobacter capsulatus: RCAP_rcc00571Help
Entry
RCAP_rcc00571     CDS       T01213                                 

Gene name
nifD
Definition
(GenBank) nitrogenase molybdenum-iron protein alpha chain
  KO
K02586  nitrogenase molybdenum-iron protein alpha chain [EC:1.18.6.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00625  Chloroalkane and chloroalkene degradation
rcp00910  Nitrogen metabolism
rcp01100  Metabolic pathways
rcp01120  Microbial metabolism in diverse environments
Module
rcp_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RCAP_rcc00571 (nifD)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RCAP_rcc00571 (nifD)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     RCAP_rcc00571 (nifD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ADE84336
UniProt: D5ANI2
Position
complement(612092..613597)
Genome map
AA seq 501 aa AA seqDB search
MAKDHAGGPEDLENLIAEVLEAYPAKAQKKRAKHLSVAGATSEDADAVTGIASKCDTVKS
NIKSVPGVMTIRGCAYAGSKGVVWGPIKDMVHISHGPVGCGHYSWSQRRNYYTGKTGVDS
FVTMQFTTDFQEKDIVFGGDKKLEKTIDEINELFPLSKGITIQSECPIGLIGDDIEAVSK
KKNKEINKTIVPVRCEGFRGVSQSLGHHIANDAVRDWIFEQPESEATKAFEPGPYDVNII
GDYNIGGDAWASRILLEEIGLNVIGCWSGDATLAEMERAPKAKLNLIHCYRSMNYICRYM
EEKYSIGWMEYNFFGPTQIEASLRAIGAKFDETIQANVEKVIAKYRPLVDGILAKYKPRL
EGKSVMLYVGGLRPRHVVTAYDDLGMVIAGTGYEFAHNDDYKRTGHYVKEGTLIYDDVTG
YELEKFIEKIRPDLVGSGIKEKYPVQKMGIPFRQMHSWDYSGPYHGYDGFAIFARDMDMA
INNPVWGLFDAPWDKAPIAAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagatcacgcgggcggcccggaagacctcgagaacctgattgcggaagttctc
gaagcctatccggcgaaagctcagaagaaacgcgccaaacacctctcggtggccggtgcg
accagcgaagacgccgacgccgtcaccggcatcgcgtcgaaatgcgacaccgtcaaatcg
aacatcaaatcggtcccgggcgtgatgaccattcgtggttgcgcctatgccggttcgaaa
ggcgtggtctggggtccgatcaaggacatggtccacatcagccacggcccggtcggctgc
ggccactattcgtggagccagcgccgcaactactacaccgggaaaaccggcgtggacagc
ttcgtgacgatgcagttcaccaccgatttccaggaaaaggacatcgtcttcggcggcgac
aagaagctggaaaagacgatcgacgagatcaacgaactgttcccgctgtcgaaagggatc
acgatccagtcggaatgcccgatcggcctgatcggcgacgacatcgaggccgtttcgaag
aagaagaacaaggaaatcaacaagaccatcgttccggtgcgttgcgaaggtttccgcggt
gtgtcgcaatcgctgggccaccacatcgccaacgacgccgtgcgcgactggatcttcgag
cagcccgagtcggaagcgaccaaggccttcgagcccggcccctatgacgtcaacatcatc
ggtgactacaacatcggtggcgacgcctgggcctcgcgcatcctgctcgaggaaatcggt
ctgaacgtgatcggctgctggtcgggcgatgcgacgctggcggaaatggaacgggcgccg
aaggcgaagctgaacctgatccactgctaccggtcgatgaactacatctgccgctacatg
gaagaaaagtattcgatcggctggatggaatacaacttcttcggcccgacccagatcgaa
gccagcctgcgcgccatcggcgccaagttcgacgagaccatccaggccaatgtcgaaaag
gtcatcgccaaataccggccgctggtcgatggcatcctggccaagtacaagccgcggctc
gaaggcaagtcggtgatgctttacgtcggcggcctgcgtccgcgccacgtcgtcaccgcc
tatgacgatctgggcatggtgatcgccgggacgggctatgaattcgcccataacgacgac
tacaagcgcaccggccattacgtcaaggaaggcacgctgatctatgatgacgtcaccggc
tacgagctggagaagttcatcgagaagatccgccccgacctcgtcggctcgggcatcaag
gaaaagtatccggtgcagaagatgggcattccgttccgtcagatgcacagctgggactac
tcgggcccctatcacggctacgacggcttcgcgatcttcgcgcgcgacatggacatggcg
atcaacaaccccgtctggggcctgttcgacgcgccctgggacaaagcccccatcgccgcc
gagtga

DBGET integrated database retrieval system