KEGG   Rhodobacter capsulatus: RCAP_rcc00573Help
Entry
RCAP_rcc00573     CDS       T01213                                 

Gene name
fdxD
Definition
(GenBank) ferredoxin V
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(614815..615186)
Genome map
AA seq 123 aa AA seqDB search
MPNITFTSPIMKKDKTIYAVAGNTATILALAKEHAIPIPFECGDGDCASCLIEVTHLDNK
PAMAMMLTEKEKARLKELQMITAEEIEAAEVSDLPPRFRLACQFIPRDEDVMVHFTGTPG
GSV
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacatcacctttacgtcgcccatcatgaagaaggacaagaccatctacgcggtg
gcgggcaacaccgcgacgatcctggcgctggccaaggaacatgcgatcccgatcccgttc
gaatgcggcgacggcgattgcgcctcctgtctgatcgaggtcacccatctcgacaacaag
cccgcgatggcgatgatgctgaccgaaaaggagaaggcgcggctgaaagagctgcagatg
atcaccgccgaggagatcgaggcggccgaggtcagcgacctgccgccgcgcttccgtctg
gcctgccagttcatcccgcgcgatgaagacgtgatggtgcatttcaccggcacccccggc
ggctcggtctga

DBGET integrated database retrieval system