KEGG   Rhodobacter capsulatus: RCAP_rcc00585Help
Entry
RCAP_rcc00585     CDS       T01213                                 

Gene name
anfH
Definition
(GenBank) nitrogenase iron protein
  KO
K02588  
nitrogenase iron protein NifH [EC:1.18.6.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
Chloroalkane and chloroalkene degradation
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RCAP_rcc00585 (anfH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RCAP_rcc00585 (anfH)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     RCAP_rcc00585 (anfH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
626073..626900
Genome map
AA seq 275 aa AA seqDB search
MTRKIAIYGKGGIGKSTTTQNTAAALAFFHEKNVFIHGCDPKADSTRLILGGLPQQTVMD
TLRIEGAERVTVDKVVKTGFKDIRCVESGGPEPGVGCAGRGVITAIDLMEENEAYSEDLD
FLFFDVLGDVVCGGFAMPIRDGKAEEVYIVASGEMMAIYAANNICKGLAKYARQSGVRLG
GIICNSRNVDGEKEFLEEFTKAIGTKMIHFVPRDNIVQKAEFNKQTVTEFQPEANQAQEY
RELGRKIIENEDFVIPKPLAMDELEAMVVKYGLMD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaagatcgccatttacggcaaaggtggtatcggcaaatcgacgaccacccag
aacaccgccgcagcccttgcctttttccacgaaaagaacgtcttcatccacggctgtgac
ccgaaagccgacagcacccggctgatcctgggcggtctgccgcagcagacggtgatggac
acgctgcgcatcgagggcgccgagcgcgtcaccgtggacaaggtcgtgaagaccggcttc
aaggacatccgctgcgtggaatcgggcgggccggagccgggcgtgggctgcgccggtcgc
ggcgtcatcaccgccatcgacctgatggaagaaaacgaagcctacagcgaagaccttgat
ttcctgttcttcgacgtgctgggcgacgtggtttgcggcggcttcgccatgcccattcgc
gacggcaaggcggaggaagtctatatcgtcgcctcgggcgagatgatggcgatctatgcc
gccaacaacatctgcaagggtctggcgaaatacgcccggcaatcgggcgtgcgtctgggc
gggatcatctgcaacagccgcaatgtcgatggcgaaaaggaattccttgaggaattcacc
aaggccatcggcaccaagatgatccacttcgtgccgcgcgacaacatcgtgcaaaaggcc
gagttcaacaagcagaccgtgaccgaattccagcccgaggccaatcaggcgcaggaatac
cgcgaactcggccgcaagatcatcgagaacgaggatttcgtgatcccgaagccgctcgcc
atggatgagctggaagccatggtcgtcaaatacggcctgatggactga

DBGET integrated database retrieval system