KEGG   Rhodobacter capsulatus: RCAP_rcc00589Help
Entry
RCAP_rcc00589     CDS       T01213                                 

Gene name
anfO
Definition
(GenBank) nitrogenase iron-iron accessory protein AnfO
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AnfO_nitrog
Motif
Other DBs
NCBI-ProteinID: ADE84354
UniProt: D5ANK0
Position
630362..631042
Genome map
AA seq 226 aa AA seqDB search
MQIAVFLDDTGQPVSLNAPGRLVLYEGSGDDWRLVEDWPLELPRAGGIAALRAAVERMVF
ALAPCTVLISAEVRGYVYSLLQEQYGFSVWRSTGPVEAMLASVCVGEEERAREAACCDTK
PEAGCGSCGSKVTAISPPPEVQAEDRPDGSRFIDLAATLAADARHNSRSVLGPVLAAEPF
RPLSIRMDHQPRWFARTLRAMGLRFTEDRREGALFVTVTLEKELAQ
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgcggtttttctggacgacaccggccagcccgtcagcctgaacgccccgggt
cggctggtcctttacgagggcagcggcgatgactggcggcttgtcgaggactggccgctg
gaattgccgcgcgcgggcggcatcgcggccctgcgcgccgccgtcgaacgcatggtcttc
gcgcttgccccctgcaccgtgctgatctcggccgaggtgcgcggctatgtctattcgctc
ttgcaggaacaatacggcttttccgtctggcgctcgaccgggcccgtcgaggcgatgctc
gcctcggtctgcgtgggcgaggaggaacgggcgcgtgaggccgcctgttgcgacacgaaa
cccgaggccggttgcggcagctgcggcagcaaggtcaccgcgatttccccgccgcccgag
gtgcaggcggaagaccgccccgacggcagccgcttcatcgatctggccgcgacgcttgcc
gccgatgcgcggcacaattcgcgttcggtcctggggccggtccttgcggccgaaccgttc
cgcccgctctcgatccgcatggatcatcaaccgcgctggttcgcccgcaccctgcgcgcc
atgggcctgcgcttcaccgaagaccgccgcgagggcgcgctattcgtgaccgtcaccttg
gaaaaggaacttgcgcaatga

DBGET integrated database retrieval system