KEGG   Rhodobacter capsulatus: RCAP_rcc00598Help
Entry
RCAP_rcc00598     CDS       T01213                                 

Definition
(GenBank) peptidase, M20 family, amidohydrolase
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer EccE
Motif
Other DBs
NCBI-ProteinID: ADE84363
UniProt: D5ANK9
Position
complement(640431..641582)
Genome map
AA seq 383 aa AA seqDB search
MRTRLSNSDVIALTAFRQALHRAPEVSGAEAGTARAVVAELMKSRPDRLLTGLGGHGVAA
IWEGAEPGPTVLIRCELDALPILETGTVAHRSDVPGKAHLCGHDGHMAIVAGVARGLARQ
KPRRGRAVLLFQPAEEDGSGAAAVIADPAFAQIRPDLALSLHNYPGLALGQAVVRPGPAN
CASRGIRIRLTGRTAHAAQPETGLSPGPALAQLIARLPGLGKGGPVTDPAFSLVTVTHAR
LGEPAFGIAPAEAELWATLRTQTDAGMAALVAATEAAVAEAAERLGTSLSYHDIFTACTN
APEAVAVLRAALAAEAIPEGDTEVPMRASEDFGRFGALAPAAMLLLGAGEASPSLHNSDY
DFPDSLIPVGAALFLRCLADQLG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgcggctgagcaattccgacgtgatcgcgctgaccgccttccgccaggcgctg
caccgcgcgcccgaggtttcgggcgcggaggccgggaccgcccgggccgtcgtggcggag
ctgatgaaatcccggcccgaccggcttctgaccgggctgggcggccatggcgtcgcggcg
atctgggagggggctgagcccgggccgacggtgctgatccgctgcgagctggatgcgctg
ccgatccttgagaccggcaccgtcgcgcatcgctcggacgtgccgggcaaggcgcatctg
tgcgggcatgatggccatatggcgattgtcgcgggcgtcgcccgggggcttgcgcggcag
aaaccccggcgcggccgggcggtgctgctgttccagcccgccgaggaggacggatcgggg
gcggcggcggtgatcgccgatccggcttttgcgcagatccgccccgatctggcgctgtcc
ttgcacaattaccccggtctggcgctggggcaggcggtggtgcgccccgggcctgccaat
tgcgcctcccgcgggatccggatccggctgaccggccgcaccgcccatgcggcgcagccc
gagacggggctttcgccgggcccggcgctggcgcagctgatcgcgcggctgcccggtctg
ggcaagggcggcccggtcaccgatccggcgttttcgctcgtcaccgtcacccatgcccgg
ctgggcgagcccgccttcggcatcgcccccgccgaggccgagctttgggcgacgctgcgc
acccagaccgatgcgggcatggccgcgctggtcgccgcgaccgaagccgcggtggccgag
gccgccgagaggctgggcacaagcctttcgtatcacgacatcttcaccgcctgcaccaat
gcgcccgaggcggtggcggtcctgcgcgcggcactggcggccgaggcgatccccgagggt
gacacggaggtgccgatgcgcgcctccgaggatttcggccgtttcggcgcgctggccccc
gcggcgatgctgcttctgggtgcgggcgaggccagccccagcctgcacaattccgattac
gatttccccgacagcctgatccccgtcggcgccgcgctgttcctgcgctgcctggccgat
cagctgggctga

DBGET integrated database retrieval system