KEGG   Rhodobacter capsulatus: RCAP_rcc00610Help
Entry
RCAP_rcc00610     CDS       T01213                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
653458..653634
Genome map
AA seq 58 aa AA seqDB search
MGYSTPKKQLDLKEFLAQPAKKPAYRNGLSFRKLGTQARGSTVPAATAPKAADGAQES
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgggctattccaccccgaagaaacaactggatctgaaggaatttctggcgcagccggca
aagaagccggcctatcgcaacggtctttccttccgcaagctcggcacgcaggcgcgcggc
agcaccgtgcccgccgcgacggcgccgaaggccgcggacggcgcgcaggagagctga

DBGET integrated database retrieval system