KEGG   Rhodobacter capsulatus: RCAP_rcc00610Help
Entry
RCAP_rcc00610     CDS       T01213                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ADE84375
UniProt: D5ANM1
Position
653458..653634
Genome map
AA seq 58 aa AA seqDB search
MGYSTPKKQLDLKEFLAQPAKKPAYRNGLSFRKLGTQARGSTVPAATAPKAADGAQES
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgggctattccaccccgaagaaacaactggatctgaaggaatttctggcgcagccggca
aagaagccggcctatcgcaacggtctttccttccgcaagctcggcacgcaggcgcgcggc
agcaccgtgcccgccgcgacggcgccgaaggccgcggacggcgcgcaggagagctga

DBGET integrated database retrieval system