KEGG   Rhodobacter capsulatus: RCAP_rcc00611Help
Entry
RCAP_rcc00611     CDS       T01213                                 

Gene name
nikR
Definition
(GenBank) nickel-responsive regulator NikR
  KO
K07722  CopG family transcriptional regulator, nickel-responsive regulator
Organism
rcp  Rhodobacter capsulatus
Brite
Transcription factors [BR:rcp03000]
 Prokaryotic Type
  Ribbon-helix-helix
   CopG family
    RCAP_rcc00611 (nikR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NikR_C RHH_1
Motif
Other DBs
NCBI-ProteinID: ADE84376
UniProt: D5ANM2
Position
653710..654180
Genome map
AA seq 156 aa AA seqDB search
MQRITITIEDDLLAALDGFMARSGASNRSEALRDLVRRGLAEDTPETAECVGVITYALDP
AQRDLGRVVPESRQRHHDTTIAALSVPLDHHAAVEVAVMRGTVGSVQAYANSLFLQRGVL
HGQTALIPVKTEIEFHLHGTRAHTHEHLRVQERWKP
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcatcaccatcaccatcgaagacgatcttctggccgcgcttgacgggttcatg
gcgcggtccggggcctcgaaccgctccgaggcgctgcgcgatctggtccgccgcggcctg
gccgaggacacccccgagaccgccgaatgcgtcggcgtgatcacctatgcgcttgatccc
gcgcagcgcgatctgggccgcgtggtgcccgaaagccgccagcgccatcacgacaccacg
atcgccgcgctgtcggtgccgctggatcatcacgccgcggtcgaagtggcggtgatgcgc
ggcacggtcggctcggtgcaggcctatgccaattcgctgtttctgcaacgcggcgtgctg
cacggacagaccgcgctgatcccggtcaagaccgagatcgagttccatctgcacggcacc
cgcgcccatacccatgaacatctgcgcgtgcaggagcgctggaagccctga

DBGET integrated database retrieval system