KEGG   Rhodobacter capsulatus: RCAP_rcc00614Help
Entry
RCAP_rcc00614     CDS       T01213                                 

Definition
(GenBank) RND efflux system, outer membrane lipoprotein, NodT family
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
655422..656774
Genome map
AA seq 450 aa AA seqDB search
MVRIGRRGFLLGATAALAGCAQVDYAAPAAKVPATFEAAAPGRAAAGPWWSAFRDPTLDQ
LIAAGRARNLDVLQAIAAIEEARASVSGAGAADLPQVSGTLKDTRGNTSGTGIAESRSGA
LAVGWTADLFGANRANRAAASARLDAAYASADVARLVMEGAIAQAYAELRYQQASIALTR
KSLESRRKSLELTRAQVESGTAGRLELLQAEQLVAEGEAQLPGYETAFDQALVTLATLTA
QPVSALRPQLSRGAGQPRPRFKASVGVPADVLRTRPDVRLAERNYAAAVYDIGVAKAAFY
PSVTLSGSVTPTHVRDANTIRYWAVGPSLNLPIFTGGANQANLRGAEARAVQAKLAWEKA
VLTAIDEVESALAAYNRDGRNIAAQTHLVATSAETLELSRTNYSLGEGDFMTVLDAERSY
LSAQQSAAAAEWSRAADFITLSIAAAGGLR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggatcgggcggcggggatttcttctgggggcgacggcggcgctggcgggctgc
gcgcaggtcgattacgcggcccccgcggccaaggttccggccactttcgaggcggcggcg
ccggggcgggcggccgcggggccgtggtggtcggccttccgcgatccgacgctcgatcag
ctgatcgcggcggggcgggcgcgcaaccttgatgtgctgcaggccatcgccgcgatcgag
gaagcccgggccagcgtctcgggcgcgggcgcggcggatctgccgcaggtctcgggcacg
ctgaaggacacgcgcggcaacacctccggcaccggcatcgccgagtcgcgctcgggggcg
cttgcggtgggctggacggcggatctgttcggggcgaaccgggccaatcgtgccgcggcc
tcggcgcggctggatgcggcctatgcctcggccgatgtggcgcggctggtgatggagggc
gccatcgcccaggcctatgcagagctgcgctatcagcaggcctcgatcgcgctgacgcgc
aaatccctggaaagccgtcgcaaaagtctggaactgacgcgggcgcaggtggaaagcggc
acggcggggcggcttgaactgctgcaggcggaacagctggtggccgagggcgaggcgcag
ctgccgggctacgagaccgctttcgatcaggcgctggtgacgcttgcgacgctgaccgca
cagccggtctcggcgctgcgcccgcagctgagccggggggcgggccagccgcggccgcgt
ttcaaggccagcgtcggcgtgcccgccgatgtgctgcgcacccggcccgacgtgcgtctg
gccgagcgcaactatgccgccgcggtctatgatatcggcgtcgccaaggcggccttctac
ccttcggtcacgctctcgggctcggtcacgccgacgcatgtgcgcgacgccaacaccatt
cgctattgggcggtcggcccctcgctcaatctgccgatcttcaccggcggcgccaatcag
gcgaacctgcgcggcgccgaggcgcgggcggtgcaggcgaaactggcctgggaaaaggcc
gtgctgaccgcgatcgacgaggtcgaaagcgcgctggccgcctataaccgcgatggccgc
aacatcgccgcgcagacgcatctggtcgcgaccagcgccgaaacgctggagctttcgcgc
accaattattccttgggcgagggcgatttcatgactgtcctcgatgccgaacgcagctat
ctttcggcgcagcaaagcgctgccgccgccgaatggagccgcgccgccgacttcatcacc
ctcagcatcgccgccgcgggcggcctgcgttga

DBGET integrated database retrieval system