KEGG   Rhodobacter capsulatus: RCAP_rcc00619Help
Entry
RCAP_rcc00619     CDS       T01213                                 

Definition
(GenBank) ABC transporter, permease protein
  KO
K01992  
ABC-2 type transport system permease protein
Organism
rcp  Rhodobacter capsulatus
Module
ABC-2 type transport system
Brite
Transporters [BR:rcp02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    RCAP_rcc00619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
664898..666016
Genome map
AA seq 372 aa AA seqDB search
MRSLRNILWLTGKELRAIRTDRVMLVLIAYVFTLAVWLVSDAASTEVDHLATAIVDEDRS
PLSARLSDAIRPPLFAAPVPMTAGQAAAAQRAGEAILVLTIPPDFERDLHAGRATTLQIL
VDATAVAQAGNGASFLRQTLLQELSAALTPGAASADPVTVVFRNAFNPNLTSSWFSAVMQ
LMNNVTILMLILSGASMIREREHGTIEHVLVMPVRPHEIVAAKILASGAVILLASLFSLV
VVVEGAMGVPVAGSLWLYAGGAAIYVVAVASLGLLLASFTRTMGQFGLLVIPVIVLMILL
SGGMTPLESMPDWLQGTMRTISPATHFVIFAQAVLYRGAGLSLVWPEMAVMAGMAAVAVT
IVLARFRKVLAG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagccttcgcaacatcctttggctgaccggcaaggagctgcgggcgatccgcacc
gaccgggtgatgctggtgctgatcgcctatgtcttcaccctggcggtctggctggtctcc
gacgccgccagtaccgaggtggatcatctggccaccgccatcgtggacgaggaccgcagc
ccgctctccgcccggctgagcgatgcgatccgcccgccgcttttcgccgcgccggtgccg
atgaccgccgggcaggccgccgccgcccaacgcgcgggcgaggcgatcctggtgctgacg
atcccgcccgatttcgagcgcgacctgcatgcgggccgcgcgacgacgctgcagatcctt
gtcgatgcgacggcggtggcgcaggcgggcaatggcgccagtttcctgcgccagaccctg
ttgcaggagctttccgccgcgctgacgcccggggccgccagcgccgatccggtcaccgtc
gtctttcgcaacgccttcaacccgaacctgacctccagctggttcagcgcggtgatgcag
ctgatgaacaatgtcaccatcctgatgctgatcttgtccggggcctcgatgatccgcgag
cgcgaacatggcacgatcgaacatgtgctggtgatgcccgtccgcccgcacgagatcgtc
gcggcgaagatcctcgcctcgggggcggtgatccttctggcctcgctcttcagcctggtc
gtggtggtcgagggggcgatgggcgttccggtggcgggctcgctttggctttatgccggg
ggggcggcgatctatgtggtggcggtggccagcctgggtctgcttctggcgtcgttcacc
cggacgatggggcaattcgggcttctggtcattccggtgatcgtgctgatgatcctcttg
tcgggggggatgacgccgctggaatcgatgcccgactggctgcagggcacgatgcggacg
atttccccggcgacgcatttcgtcatcttcgcccaggcggtgctctatcgcggcgcgggg
ctgtcgctggtctggccggaaatggcggtgatggcgggcatggcggcggtggcggtgacg
atcgttctggcgcggtttcgcaaggtgctggcgggctag

DBGET integrated database retrieval system