KEGG   Rhodobacter capsulatus: RCAP_rcc00622Help
Entry
RCAP_rcc00622     CDS       T01213                                 

Gene name
moeA
Definition
(GenBank) molybdopterin biosynthesis protein MoeA
  KO
K03750  
molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RCAP_rcc00622 (moeA)
Enzymes [BR:rcp01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     RCAP_rcc00622 (moeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(669799..671043)
Genome map
AA seq 414 aa AA seqDB search
MPALDHPASAMLDLDSARRLACGLVAPIGDSETLDLAQAAGRTSATSLRAEIALPRAARS
AMDGFALRTADLAAALTLPVAGTVAAGMQAPPLPDGAALRIFTGAQIPAGADAVVPVEEV
TETGAEVQLTAAPAPGSHIRAVGSEQPLGGLLLRRGTRIRAHHIGLLASNGVAEVAVVRR
PRLAILSTGDELHRPGAEAASRDTMPDVNRPMLIALAQGAGAEVDDHGILPDDAEATVAK
FASLQGRYDLIVTTGAVSMGGRDHLRPALIAAGGQIDGWKVALKPGKPVMFGRLGNAAVT
GLPGNPFSAMVGFTLFVSAQIARLKGAVPAPLFHCAGRAGFDWTRKPDRAEIFPIRLGNR
EIDGLPVVHRLGEGTSATLFPLAEADGLGFVPAETARVSVGTPICWQTFEAGAR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcactcgatcacccggcatccgcgatgctcgacctcgattccgcccgccgtctg
gcctgcggtctggtcgcgcccatcggcgacagcgaaaccctcgatctggcgcaggcggcc
gggcgcacctctgccaccagcctgcgcgccgagatcgccctgccccgcgccgcccgctcg
gcgatggacggctttgcgctgcgcaccgccgatctggccgccgctctgacgctgcccgtc
gcgggcacggtcgcggccgggatgcaggcgccgcccctgcccgacggcgccgcgctgcgc
attttcaccggggcgcagatccccgcgggcgccgatgccgtcgtgccggtcgaagaggtg
accgagaccggcgccgaggtgcagctgaccgccgcccccgcgccggggtcgcatatccgc
gccgtggggtcggaacagccgctgggcgggcttttgctgcgccgcggcacccggatccgg
gcgcatcacatcggccttctggcctcgaacggcgtggccgaggtcgcggtggtgcgccgt
ccgcggctggcgatcctctcgaccggcgacgagctgcaccggccgggggccgaagcggcg
tcacgggacacgatgcccgatgtgaaccggccgatgctgatcgcgctggcgcagggcgcc
ggggcggaggtcgacgatcacggcatcctgcccgacgatgccgaggcgaccgtggcgaaa
ttcgccagcctgcaggggcgctatgatctgatcgtgacgacgggcgcggtgtcgatgggc
gggcgcgatcacctgcgcccggccctgatcgcggcgggcgggcagatcgacggctggaaa
gtggcgctcaaacccggcaagccggtgatgttcggccgtctgggcaatgccgcggtgacc
ggcctgccgggcaatccgttctcggcgatggtcgggttcacgctcttcgtctcggcgcag
atcgcccggctgaagggggcggttccggcgccgctgttccactgtgccgggcgggccggc
ttcgactggacccgcaagccggaccgggccgagatcttcccgatccggctgggcaaccgg
gaaatcgacggcctgccggtggtgcaccgtctgggcgagggcacctcggccacgcttttc
ccgctggccgaggccgatggtctgggcttcgtcccggccgagaccgcccgggtcagcgtc
ggcacgccgatctgttggcagaccttcgaggccggggcgcgctga

DBGET integrated database retrieval system