KEGG   Rhodobacter capsulatus: RCAP_rcc00629Help
Entry
RCAP_rcc00629     CDS       T01213                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
676447..677172
Genome map
AA seq 241 aa AA seqDB search
MTAAVILRELAGVAELQQAERFQVEVWGEGERPDNSDIMLALQHEGALVAGAFAGDQMLG
FLFGFPSATPGVQHSHRLAVSQKARGLGLGARLKWFQRDWCLARGITLVRWTYDPLRAIN
AGLNIAVLGATAREYLPDYYGPMPGINAGLPSDRVMAVWQLDAPQVVARAAGQSPTLPPA
AATAGIPADIDALLQADPDRALAERMRLRAALQEAFAAGLAITGFDRQSCRYLLDRPAAA
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgcggtgatcctgcgcgagcttgcgggcgttgcggaactgcagcaggccgaa
cgctttcaggtcgaggtctggggcgagggcgagcggcccgacaacagcgacatcatgctg
gcgctgcagcacgaaggcgcgctggtggccggggccttcgcgggcgatcagatgctgggg
tttctcttcggtttcccctcggccacgccgggggtgcagcattcgcaccggctggcggtg
tcgcaaaaggcgcgcgggctgggccttggcgcgcggctgaaatggttccagcgcgactgg
tgtctggcgcgcggcatcacgctggtgcgctggacctatgatcccctgcgcgcgatcaat
gccgggctgaacatcgccgttctgggggcgacggcgcgggagtatctgcccgattattac
ggcccgatgcccggcatcaatgccggtctgccctcggaccgggtgatggcggtctggcag
ctggacgcgccgcaggtcgtcgcccgggccgcgggccagtccccgaccttgccgcccgcc
gcggccacagccgggatcccggccgatatcgatgcgctcttgcaggccgatcccgaccgc
gccctggccgagcggatgcgcctgcgcgccgcgctgcaggaggccttcgccgccggtctg
gcgatcaccggcttcgaccgccagagctgccgctatctgctcgaccggcctgcggcggcc
gcttaa

DBGET integrated database retrieval system