KEGG   Rhodobacter capsulatus: RCAP_rcc00634Help
Entry
RCAP_rcc00634     CDS       T01213                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
rcp  Rhodobacter capsulatus
Module
rcp_M00258  Putative ABC transport system
Brite
Transporters [BR:rcp02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    RCAP_rcc00634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 AAA_16 AAA_30 vMSA AAA_28 ATPase
Motif
Other DBs
NCBI-ProteinID: ADE84399
UniProt: D5ANP5
Position
complement(687442..688167)
Genome map
AA seq 241 aa AA seqDB search
MLGIDQLATTLSKGERSFTLRVAALELVSGEVLCVTGASGTGKTLFLELLSLLRAPEPPA
GYHWTAPDRRRTDLARLWRFGARGTGLARMRGALFGFVPQAGALVPFLSVRANVALTQRI
SGRRDPARVAALLDRLGLNALADLPPSALSIGQRQRVSIARALAHRPAFVIADEPTAALD
PAAADAVMRLLLDTAREDGAGVVLSSHDLARIEGLGPRRLEFVARELRPGLVRSEAREVR
C
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgggatcgaccagctcgcgacgaccctgtcgaagggggagcgcagcttcacgctg
cgcgtcgcggcgctggagctggtgtcgggcgaggtgctttgcgtcaccggcgccagcggc
accggcaagaccctgtttctggaactgctgagccttctgcgggcgccagagcccccggcc
ggatatcattggaccgcgccggaccggcggcggaccgatctggcgcggctgtggcgcttt
ggcgcgcgcggcaccgggcttgcgcggatgcgcggcgcgctgttcggcttcgtgccgcag
gcgggggcgctggtgccgttcctgtcggtccgggccaatgtggcgctgacgcaaaggatc
agcgggcgccgcgatccggcccgggtcgcggcgctgctcgaccggctcgggctgaacgcg
ctggccgatctgccgccctcggcgctgtcgatcgggcagcggcagcgggtctcgatcgcg
cgggcgctggcgcatcgcccggccttcgtgatcgccgacgagccgacggcggcgctcgat
cccgcggcggccgatgcggtgatgcggttgctgctcgacaccgcgcgcgaggacggcgcg
ggggtggtgctgtcgtcgcatgatctggcgcggatcgaggggctgggcccgcggcggctg
gaattcgtcgcccgcgagctgcgtccggggctggtgcggtccgaagcgcgggaggtccga
tgctga

DBGET integrated database retrieval system