KEGG   Rhodobacter capsulatus: RCAP_rcc00636Help
Entry
RCAP_rcc00636     CDS       T01213                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(690081..691193)
Genome map
AA seq 370 aa AA seqDB search
MTLTVQRDPGHGAGGHALLRVENGAALPDEVTVSVFETYSERWLAPSAQDGPAGISVGAP
NWQAGRHLFGPYRVQRRDGAAEIAIGPEIVNKIEGYTQVRIVAGPVEGHLFWPNDIQPLD
LARQRIGLQVARRTGAAQGPEPALRQAEAGVTAPPPLPPDAPMTEQDSAGIAAPEPRRRR
WLWLVLALALVVLAALLGLGYSRYLQQQWPFSAGVEPPPAPETPPGPTPEPAPAPTPEPA
AATPGQADPCTPEALGALGGITAITRAAGACGQRVGRDQMLIFVETAAQAGDAEALLLFG
TLYDAAVTDPTVETQLGLSFADAPAQAADYYSRARAAGSAAAAGRLTAVCARLRAAEDTL
SRGALDDFCR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgacggttcagcgcgatcccggccacggcgcgggcgggcatgcgctgcttcgg
gtcgaaaacggcgcggcgctgcccgacgaggtgacggtttcggtgttcgaaacctattcc
gaacgctggcttgcgccctcggcgcaggacggcccggcggggatttccgttggcgcgccg
aactggcaggccgggcggcacctgttcggcccctaccgggtgcagcgccgcgacggcgcg
gccgaaatcgccatcggcccggaaatcgtcaacaagatcgagggctatacccaggtcagg
atcgtcgcgggcccggtcgagggccatctgttctggccgaacgacatccagccgctcgat
ctggcccggcagcgcatcggcctgcaggtcgcgcgcaggaccggcgcggcacaggggccg
gaaccggccttgcggcaggccgaggcgggcgtgaccgcgccgccgccgctgccgcccgac
gcgccgatgacggagcaggacagcgccgggatcgcggcccccgaaccgaggcgccgccgc
tggctctggctggtgctcgcgctggcgctggtggttttggcggcgctgctcgggcttggt
tattcccgatacctgcagcagcaatggccgttttcggccggggtggagcccccgccagcc
ccggaaacgccgcccggaccgacaccggaaccggcgcctgcaccgacaccggaaccggcc
gccgcgacgccggggcaggccgatccctgcacgcccgaggcgctgggcgcgctgggcggc
atcaccgcgatcacccgcgccgccggggcctgcggccagcgggtggggcgcgaccagatg
ctgatcttcgtcgagaccgcggcgcaggcgggcgatgccgaggcgctgttgctgttcggc
acgctttacgacgccgccgtcaccgatccgacggtggaaacgcaactggggctgagcttt
gccgatgcccccgcccaggcggccgattactattcgcgggcccgggcggcgggctcggcc
gcggcggcgggccggttgaccgcggtctgcgcgcggctgcgcgcggcggaagataccttg
tcacggggggcgcttgatgacttttgccgctag

DBGET integrated database retrieval system