KEGG   Rhodobacter capsulatus: RCAP_rcc00641Help
Entry
RCAP_rcc00641     CDS       T01213                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: ADE84406
UniProt: D5ANQ2
Position
complement(700087..700797)
Genome map
AA seq 236 aa AA seqDB search
MRIVSIWVGGAALLAVSAATAALLLPSCEVALPFGSLRLGSCPGTILQDPLAEDRVASAA
LRAEIRSLEARLAGLDCPAPVAAPLPAPEPLPEPAPEPEPDPPPVLDKDMIDKADLGDLQ
GCWALDSPYRTQNRATGEITEFSEWTVCFDAGGNGTETMRGSNGIRCEGPVSGSFVPGQA
LVIEEAANLPCSNDMEILQRRVTCRVDGAERASCSSFQPESGSSSEVIMRRTQEAP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgtctcgatctgggtagggggcgcggcccttcttgcggtctcggccgcaacg
gcggcgctgctgcttccctcctgcgaggtcgcgctgcccttcggcagcctgcggcttggc
agctgtccgggcacgatcctgcaagatccgctggccgaggaccgcgtcgcaagcgcggcg
ctgcgcgccgagatccgcagcctcgaggcccggcttgcggggcttgactgtcccgcgccc
gtcgcagcgcccctgcccgcccccgagccgctgccggaaccggcgccggaaccggagccc
gacccgccgccggtgctggacaaggacatgatcgacaaggccgatctgggcgatctgcag
ggctgctgggcgcttgacagcccctatcgcacgcaaaaccgcgccaccggcgagatcacc
gaattttcggaatggacagtgtgctttgacgccgggggcaatggcaccgagacgatgcgg
ggctcgaacggcatccgctgcgaggggccggtcagcggcagcttcgtcccggggcaggcg
ctggtgatcgaggaggccgccaatctgccctgttcgaacgacatggaaatcctgcagcgc
cgggtgacctgtcgggtcgatggcgccgagcgggccagctgttcctcgttccaacccgaa
agcggcagcagctcagaggtgatcatgcgcagaacgcaggaggcgccgtaa

DBGET integrated database retrieval system