KEGG   Rhodobacter capsulatus: RCAP_rcc00645Help
Entry
RCAP_rcc00645     CDS       T01213                                 

Definition
(GenBank) diguanylate cyclase/phosphodiesterase with PAS/PAC sensor
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_3 EAL GGDEF PAS_4 PAS PAS_9 PAS_11
Motif
Other DBs
NCBI-ProteinID: ADE84410
UniProt: D5ANQ6
Position
complement(707925..711662)
Genome map
AA seq 1245 aa AA seqDB search
MLTAPDFGSAAGEAAPETCDDPPPPVLIDFDATGRITAVLDPARLFGIAAPKAGTALTDL
FAPPDRKRMADWLASEETAATLRLGVARAGAPVLPCHVTLLRPRPAQPGRAVVTEAACAE
ELARCRAERDEIARYVDHRELGTWAWNLQTGALRCNDHWGLMLGYRPGELALPSIDTWRR
LCHPDDLQRAQHELQRHLAGESPWYEVETRMRHRDGRWIWVRDVGRLQISDAQGRPEWIY
GVRRNIDATRAREGQLRRVQGLLEKAGALAGFGCWELDVRSEEIYWSDETCRIHGMPPGT
VPPLESAIDFYAPEARPVVTEAVAAAMRDGTSWQFELPLIRADGTRIWVLSLGEAQFEDG
QPVRICGAFQDITARKEAEKRLAEAAEAARIARDRLNTLADKAPGALFEHREFPSGRIDL
PYFSARLPDLLGVPRAAIEADGAAAAANIHPEDAPQLTEAIRTSRDSLTPLVILYRLLHP
QKGLRRMQLSSMPVRQPDGSVIWYGSVLDVTEQSAMQARLAETLEELRLAHERLDTIAQN
VPGALFEMQRSGDIVSFPYFTHKFVELLGVTAADMLAGGPAVFRNIPPAEFAAVYAAFER
SRETLSQVEARHRVLLPDGSTRWVNLWASPSVQADGRVRWFGKALDITDRLEMEARATAA
AEEIRLAHARIASILDIVPVGLFEYRRSRGGSADFPYTSGRFSELVGLDRAAIDRLGGGL
LDRVLPEDRVAMEEMTRQSAASLTPWRMRFRYIHPERGQIWLMAASLPEAKPDGTVVWTG
ALYDATPDVLREAELERAYALAERMRGENEHLALHDGLTRLPNRRYFDRHIETRLRAAEL
GGPRDCVLIQIDLDHFKQINDTLGHEAGDRVLMRVADLMRSSLQADDFAARLGGDEFCLL
LAPGSTEVRARKVLERLRKGLDEPLRYRGHPCRISASFGVVIAKNITDLAEELQLYADAA
LYRAKATGRNRVEIFDHAMAEQMHLDRMMAAQFSAAFERDEFEPWFQPQVRAQDLRLAGV
EVLVRWRNPERGLLTPDAFLRVARDLRIVPEIDRVMMEKTAAVLERLETTGIILPRISFN
VCTGRLHDPALPAAVRRVGRGRTRVALELRETGDWQEEGCDLRETLARLRAEGIDIEIDD
FGSGQTSILGLMEIRPAALKIDRRIVAALRRDTHEADLVRQIVQIARTLGVATIAEGVET
MAQAETLRQMGCDILQGYLFAPPLEEAAFRDYLDRQRAPALGGLV
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atgctcactgcaccggatttcggaagtgccgcaggagaagccgcaccagagacctgcgac
gacccgccgccgccggtcctgatcgatttcgacgccaccggccggatcaccgccgtcctc
gatcccgcccggctgttcgggatcgccgcgccaaaggccggaacggcgctgacggatctt
ttcgcgccccccgaccggaaacggatggcggattggctcgcctcggaggagacggcggcg
acgctgcgtctcggggttgcgcgcgcgggggcgccggtcctgccctgccatgtcaccctg
ttgcgcccgcgcccggcacagcccggccgcgccgtcgtcaccgaagcggcctgcgccgag
gaactggcccgctgccgggccgaacgcgacgagatcgcccgctatgtcgaccacagggag
cttggcacctgggcctggaacctgcagaccggcgccctgcgctgcaacgaccattggggc
ttgatgcttggctatcggccgggggagctcgcccttcccagcatcgacacctggcggcgg
ctgtgtcatcccgacgatctgcagcgggcccagcacgagttgcaacgtcatctcgccggc
gaaagcccctggtatgaggtcgaaacccggatgcgccatcgcgatggccgctggatctgg
gtgcgcgatgtcggacggctgcagatcagcgacgcgcagggacggccggaatggatctac
ggcgtgcgccgcaacatcgacgcgacaagggcacgcgaggggcagttgcgccgggtgcag
gggcttttggaaaaggccggggcgctggcgggcttcggctgctgggaactcgacgtgcgc
agcgaggaaatctactggtccgacgagacctgccggatccatggcatgccgccgggcacg
gtgccgccgctggaaagcgcgatcgacttctacgcccccgaggcccgcccggtggtcacc
gaggcggtcgcggcggcgatgcgcgacggcacctcctggcagttcgagctgccgctgatc
cgcgccgacggcacccggatctgggtgctgtcgctgggcgaggcgcagttcgaagacggc
cagccggtccgcatctgcggcgcgttccaggacatcaccgcgcgcaaggaagcggaaaaa
cggctggcagaggcggccgaggcggcgcggatcgcacgcgaccggctgaacacgcttgcc
gacaaggccccgggggcgctgttcgaacaccgcgaatttccctcgggccggatcgacctg
ccctatttcagcgcccgtctgcccgatctgctgggcgtgccccgggccgcgatcgaggcc
gatggcgccgccgccgccgccaacatccaccccgaggatgccccgcaactgaccgaggcg
atccggacctcgcgcgacagcctgacgccgctcgtcatcctctaccggctcctgcatccg
caaaagggcctgcgccggatgcagctgtcctcgatgccagtgcgccagcccgacggctcg
gtgatctggtacggctcggtgctggacgtgaccgagcaaagcgcgatgcaggcgcggctg
gccgaaacgctcgaagagctgcggctggcgcatgaacggctggacacgatcgcgcagaac
gtccccggggcgctgttcgagatgcagcgcagcggcgacatcgtgtccttcccctatttc
acccacaaattcgtcgagcttctgggcgtcaccgcggccgacatgctggcgggcggcccg
gcggtgtttcgcaacatcccgcccgcggaattcgcggcggtctatgccgccttcgaacgc
tcgcgcgagacgctgtcgcaggtcgaggcgcggcatcgggtgcttttgcccgacggcagc
acgcgctgggtcaatctctgggcctcgccctcggtgcaggccgacgggcgggtgcgctgg
ttcggcaaggcgcttgacatcaccgaccggctggagatggaggcccgggccaccgccgcc
gccgaggagatccggctggcgcatgcgcgcatcgcctcgatcctcgacatcgtgccggtg
gggctgttcgaatatcgccgcagccgcggcggcagcgccgattttccctatacgagcggc
cggttcagcgagcttgtgggccttgatcgcgccgcgatcgaccggcttggcggcggcctg
ctggaccgggtcctgcccgaggatcgcgtggcgatggaagagatgacgcggcagagcgcg
gcaagcctgacgccctggcggatgcggtttcgctacatccatcccgaacgcgggcagatc
tggctgatggcggcctcgctgcccgaggcgaagcccgacggcacggtggtctggaccggc
gcgctttacgacgccacgcccgatgtcctgcgcgaggccgagctggaacgcgcctatgcg
ctggccgagcggatgcgcggcgaaaacgagcatctggcgctgcatgacgggctgacgcgg
ctgccgaaccggcgctatttcgaccgccacatcgagacccgcctgcgcgcggcagagctg
ggcgggccgcgcgattgcgtgctgatccagatcgatctcgatcatttcaagcagatcaac
gacacgctgggccacgaggcgggcgaccgggtgctgatgcgggtcgccgatctgatgcgc
agcagcctgcaggcggatgatttcgccgcccggcttggcggcgacgaattctgcctgctg
ctcgcgcccggcagcaccgaggtccgggcgcgcaaggtgctcgagcggctgcgcaagggg
ctggacgagccgctgcgctaccgcggccatccctgccggatcagcgcctcctttggcgtg
gtgattgcgaagaacatcaccgatctggccgaggaattgcagctttacgccgatgccgcg
ctctatcgggcgaaggcgacggggcgcaaccgggtcgagatcttcgaccatgcgatggcc
gagcagatgcatctcgaccggatgatggcggcgcagttcagcgccgccttcgagcgggac
gaattcgaaccctggttccagccgcaggtccgggcgcaggatctgcggctggccggggtc
gaggttctggtacgctggcgcaatcccgaacgcggcctgctgacgcccgatgcattcttg
cgggtggcgcgcgatctgcggatcgtccccgagatcgaccgggtgatgatggaaaagacc
gccgcggtgctggagcggctcgagacgacggggatcatcttgccacggatcagcttcaac
gtctgcaccgggcgtctgcacgatccggcgctgcccgcggcggtgcggcgggtcgggcgc
ggccggacccgggtggcgctggagctgcgcgagaccggcgactggcaggaggagggctgc
gacctgcgcgaaaccctggcgcggctgcgcgccgaggggatcgacatcgagatcgacgat
ttcggctcggggcagacctcgatcctcgggctgatggagatccggcccgcggcgctgaag
atcgaccggcgcatcgtggcggcgctgcgccgcgacacgcacgaggccgatctagtgcgg
cagatcgtgcagatcgcccgcacgcttggcgtggccaccatcgccgagggggtggagacc
atggcccaggccgagacgctgcggcagatgggctgcgacatcctgcagggctatctcttc
gcgccgccgctcgaggaagcggcctttcgcgactatctggaccggcaacgcgcccccgcc
cttggcggtctggtgtaa

DBGET integrated database retrieval system