KEGG   Rhodobacter capsulatus: RCAP_rcc00654Help
Entry
RCAP_rcc00654     CDS       T01213                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADE84419
UniProt: D5ANR5
Position
complement(720874..721509)
Genome map
AA seq 211 aa AA seqDB search
MLIAVASQNFRTISGQAGETGPFLIYEVAAGAKAQEVARIDLPEALRMPAEDPASPHPFD
DMTAVISAAATEAFGDRMAARGVLAVVSEEETDPASAAASLAVAIVEALSAAGMRLEDLE
GCGCGDHGREGCDGQGGCGGHDHDHGHDHGGCGCGGGGHHHGRGHGHGRRRGGRGCGCGG
QDHAAEAVPVLRDAPRQGGGCGCGGGGSCRG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcgctgtcgccagccagaatttccgcaccatttccggccaggccggagagacc
ggcccgttcctgatctacgaggtcgcggcgggggccaaggcgcaggaagtggcgcggatc
gacctgcccgaggcgctgcggatgcccgccgaggatcccgcctccccgcatccgttcgac
gacatgacggcggtgatttccgccgccgcgaccgaggctttcggcgaccggatggcggcg
cgcggcgttctggccgtggtcagcgaggaagagaccgatccggccagcgctgcggcttcg
cttgccgtggccatcgtcgaggcgctttcggccgcggggatgcggctggaggatctggag
ggctgcggttgtggcgatcacggccgcgagggctgcgacggtcagggcggctgcggcggc
catgaccatgaccacgggcacgaccacggcggttgcggctgtggcggcggcgggcatcac
cacgggcgcgggcatggccacgggcgccgtcgcggtgggcgcggctgcggctgtggcggc
caggatcatgcggccgaggcggttccggtgctgcgcgatgcgccgcgccagggcggcggc
tgtggctgcggcggcggcggctcttgccggggctga

DBGET integrated database retrieval system