KEGG   Rhodobacter capsulatus: RCAP_rcc00660Help
Entry
RCAP_rcc00660     CDS       T01213                                 

Gene name
pucC1
Definition
(GenBank) protein PucC-1
  KO
K08226  
MFS transporter, BCD family, chlorophyll transporter
Organism
rcp  Rhodobacter capsulatus
Brite
Transporters [BR:rcp02000]
 Major Facilitator Superfamily (MFS)
  Metal transporters
   Putative bacteriochlorophyll delivery (BCD) family [TC:2.A.1.41]
    RCAP_rcc00660 (pucC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(725111..726544)
Genome map
AA seq 477 aa AA seqDB search
MILSRRMIGSLAMTWLPFADAASETLPLRQLLRLSLFQVSVGMAQVLLLGTLNRVMILEL
GVPALVVAAMISIPVLVAPFRAILGHRSDTYRSALGWKRVPYLWFGSLWQMGGLALMPFS
LILLSGDQTMGPAWAGEAFAGVAFLMAGVGMHMTQTAGLALAADRATEETRPQVVALLYV
MFLIGMGISAVIVGWLLRDFDQITLIRVVQGCGAMTLVLNVIALWKQEVMRPMTKAEREA
PRQSFREAWGLLAAETGALRLLATVMVGTLAFSMQDVLLEPYGGQVLGLKVGQTTWLTAG
WAFGALVGFIWSARRLSQGAVAHRVAARGLLVGIVAFTAVLFSPLFGSKVLFFASAMGIG
LGSGMFGIATLTVAMMVVVRGASGIALGAWGAAQATAAGLAVFIGGATRDLVAHAAAAGY
LGSLHSPALGYTVVYVTEIGLLFITLAVLGPLVRPGSLFPKKPEAGEARIGLAEFPT
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatactctcccgccgcatgatcggttcgctggcgatgacctggctgcccttcgccgat
gcggcgtccgaaaccctgccgctgcggcaattgctgcggctgtcgctgtttcaggtttcc
gtcggcatggcgcaggtgctgcttctgggcacgctcaaccgggtgatgatcctggagctg
ggcgtgcccgcgcttgtcgtcgccgcgatgatctcgatcccggtgctggtggcgccgttc
cgcgccattcttggccaccgctccgacacctaccgctcggcgcttggctggaagcgggtg
ccctatctgtggttcggttcgctctggcagatgggcgggctggcgctgatgccgttctcg
ctgatcctgctgtcgggcgatcagaccatgggccccgcctgggcgggcgaggcctttgcg
ggcgtggccttcctgatggcgggcgtcggcatgcacatgacgcagaccgcgggtctggcg
ctggccgccgaccgcgcgaccgaggaaacccggccgcaggtggtggcgctgctttacgtg
atgttcctgatcggcatgggcatttccgccgtcatcgtcggctggctgctgcgcgacttc
gaccagatcaccctgatccgcgtcgtgcagggctgcggggcgatgacgctggttctgaac
gtcattgcgctgtggaaacaggaagtgatgcggccgatgaccaaggccgaacgcgaagcc
ccgcggcaaagcttccgcgaggcctgggggcttctggcggccgagaccggcgccctgcgg
cttctggccacggtcatggtcggcacgcttgccttttcgatgcaggacgtgcttctcgaa
ccctatggcggtcaggtgcttggcctgaaggtggggcagacgacctggctcaccgcgggc
tgggcctttggcgcgcttgtcggtttcatctggtcggcacggcgcctttcgcaaggggcc
gtggcgcatcgcgtcgctgcgcgcgggcttctggtcggcatcgtcgcctttacggcggtg
ctgttctcgccgcttttcggcagcaaggtgctgttcttcgcttctgccatgggcatcggc
cttggcagcggcatgttcggaattgccacgctgaccgtggcgatgatggtggtcgtgcgg
ggtgcttccggcatcgcgctcggcgcctggggtgcggcgcaggccacggcggcggggctt
gcggtcttcatcgggggtgcgacgcgtgacctcgttgcccacgccgccgcagcggggtat
ctggggtcactccatagcccggcgctcggctacacggtggtctatgtgaccgaaatcgga
ctgctcttcatcacccttgccgtgctcggaccgctcgttcgccccggcagccttttcccc
aagaagccggaagccggcgaggctcggatcggccttgccgaatttccaacctga

DBGET integrated database retrieval system