KEGG   Rhodobacter capsulatus: RCAP_rcc00665Help
Entry
RCAP_rcc00665     CDS       T01213                                 

Gene name
bchN
Definition
(GenBank) light-independent protochlorophyllide reductase, N subunit
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00860  Porphyrin and chlorophyll metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCAP_rcc00665 (bchN)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RCAP_rcc00665 (bchN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ADE84430
UniProt: P26164
Structure
PDB: 

Jmol
Position
complement(733308..734582)
Genome map
AA seq 424 aa AA seqDB search
MSLDSPTFGCTDSPVRRERGQKAVFCGLTSIVWLHRKMQDAFFLVVGSRTCAHLLQAAAG
VMIFAEPRFGTAVLEEQDLAGLADAHKELDREVAKLLERRPDIRQLFLVGSCPSEVLKLD
LDRAAERLSGLHAPHVRVYSYTGSGLDTTFTQGEDTCLAAMVPTLDTTEAAELIVVGALP
DVVEDQCLSLLTQLGVGPVRMLPARRSDIEPAVGPNTRFILAQPFLGETTGALERRGAKR
IAAPFPFGEEGTTLWLKAVADAYGVSAEKFEAVTAAPRARAKKAIAAHLETLTGKSLFMF
PDSQLEIPLARFLARECGMKTTEIATPFLHKAIMAPDLALLPSNTALTEGQDLEAQLDRH
EAINPDLTVCGLGLANPLEAKGHATKWAIELVFTPVHFYEQAGDLAGLFSRPLRRRALLN
GGAA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgattcgccgactttcggctgcaccgattctccggtgcggcgcgagcgtggt
cagaaagccgtgttttgcggcctgacctcgatcgtctggctgcaccgcaagatgcaggat
gctttctttctggtcgtcggctcgcgcacctgtgcgcatctgttgcaggccgccgcgggc
gtgatgatctttgccgagccgcgtttcggcaccgccgttctggaggaacaggatctggcg
gggctcgccgatgcgcacaaggaactggaccgcgaggtggcgaagcttctggagcgccgc
cccgatatccggcagctgttccttgtcggctcctgcccctcggaagtgctgaagctggat
ctggaccgcgcggccgagcggttgagcggccttcatgcgccgcatgtgcgggtttacagc
tacaccggctcggggcttgatacgaccttcacgcaaggggaagacacctgccttgccgcg
atggtgccgacgctcgacaccaccgaggcggccgagctgatcgtcgtcggcgccctgccc
gatgtggtcgaggatcagtgcctctcgcttctgacccagctgggcgtcggcccggtgcgg
atgctgcccgcgcggcgctccgacatcgagcccgccgtcggcccgaacacccggttcatt
ctggcgcagcccttcctgggcgaaaccaccggcgcgctggaacggcgcggggcgaaacgc
atcgcggcccccttcccctttggcgaggaaggcacgacgctctggctcaaggccgtggcc
gatgcctatggcgtttcggctgaaaaattcgaagccgtcaccgccgcgccgcgcgcgcgg
gcaaaaaaggcgattgccgcgcatcttgaaacgctcaccggcaagtcgcttttcatgttc
cccgacagccagctggaaattccgctggcgcggttcctcgcgcgcgaatgcggcatgaag
acgaccgagatcgccacccccttcctgcacaaggcgatcatggccccggatctggcgctt
ctgccttcgaacaccgcgctgaccgagggtcaggaccttgaggcgcaactcgaccggcac
gaggcgatcaaccccgatctgaccgtctgcggtctgggccttgcgaacccgctcgaggcc
aagggtcatgcgacgaagtgggcaatcgaactggtgttcacgccggtgcatttctacgag
caggcgggggatctggccgggttgttctcgcgcccgttgcgccgtcgtgcattgctgaac
ggaggcgcggcatga

DBGET integrated database retrieval system