KEGG   Rhodobacter capsulatus: RCAP_rcc00666Help
Entry
RCAP_rcc00666     CDS       T01213                                 

Gene name
bchF
Definition
(GenBank) 2-vinyl bacteriochlorophyllide hydratase
  KO
K11336  
3-vinyl bacteriochlorophyllide hydratase [EC:4.2.1.165]
Organism
rcp  Rhodobacter capsulatus
Pathway
Porphyrin and chlorophyll metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCAP_rcc00666 (bchF)
Enzymes [BR:rcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.165  chlorophyllide a 31-hydratase
     RCAP_rcc00666 (bchF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(734579..735094)
Genome map
AA seq 171 aa AA seqDB search
MPNSPQNPSRKALYTEEERARRDATPWTLVQAILAPLQFLAFGVSLVLVVRFLFTGEGYE
AATISILIKTLLLYTIMVTGAIWEKVVFGQYLFAPAFFWEDVFSFGVIALHTAYLWALFT
GQPDNMQMFIALAAYATYVINAGQFLWKLRQARLQAASEDAGTLVMERGTR
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgccgaactccccccaaaacccgtcgcgaaaagcactctacaccgaggaagaacgcgcc
cgcagggacgcgacgccgtggacattggtgcaggccatcctggccccgctgcagttcctg
gccttcggtgtctcgctcgtccttgtggtgagattccttttcaccggagagggttacgag
gctgcgacgatctcgatcctgatcaagacgcttttgctttacacgatcatggtgaccgga
gcgatctgggaaaaagtcgtgttcgggcagtatcttttcgcccccgccttcttttgggaa
gacgtgttttcctttggggtgatcgcgctgcacacggcctatctctgggcgcttttcacc
ggccagcctgacaacatgcagatgttcatcgcgctggctgcctatgcaacctatgtcatc
aacgccggacagttcctgtggaaactgcgtcaggcgcggcttcaggcagcttccgaagac
gccggcaccctggtgatggaacgggggacgcgatga

DBGET integrated database retrieval system