KEGG   Rhodobacter capsulatus: RCAP_rcc00668Help
Entry
RCAP_rcc00668     CDS       T01213                                 

Gene name
ppsR
Definition
(GenBank) transcriptional regulator PpsR
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_8 PAS_9 PAS_4 PAS_8 PAS
Motif
Other DBs
NCBI-ProteinID: ADE84433
UniProt: D5ANS9
Position
736334..737719
Genome map
AA seq 461 aa AA seqDB search
MRREALQRVSPDLLADIVTSACDIALVVSPGRVVESVMVNPQFGSAERFAAWQGARLSQL
FSPESAQKLENRLADGPEPGRSLQLELTHAADAFTLPVRYTITRSGEDGTLLLIGRDMQP
LAEVQQQLVKAQLALERDYEAQREIETRYRVLLEAHPAPLLIVSMSTGRIADLNLAAAAM
IGATRAELIDAPVGQELDGRRRGEFLENLAKIAGSDPLGAVELTIRRSRRKVTVTATLFR
AAGDRLLLCRLGEAEARRTRVDDTVELSERLFLKGIDAMVFLDADGTIRAANDAFLYLTD
AGSAALVQGRSFADFLSRGAVDLNVLLDNVKRIGHLRHYVTRLNTDFSGQVTVELSATLF
HDRATPTIALVIRDSNLADATRIMPGMASNEGLRNVMQMVGYATLRDIVSETTEIIEKMC
IETALELTGNNRVAAAELLSLSRQSLYVKLRKFGLLSKDAE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgggaggccttgcaaagggtctctccggacctgttggctgacatcgtgacgtcg
gcctgcgatattgccctggtggtgtccccggggcgtgtcgtcgaatcggtgatggtcaac
ccgcagttcggatccgcggaacgcttcgcggcctggcagggggcgcggctgtcgcagctt
ttcagccccgaaagcgcgcagaagctggagaaccgtctggccgacgggccggaacccggc
cggtcgctgcagcttgaactgacccatgccgccgatgccttcacgctgccggtccgctac
accatcacccgctcgggcgaggacgggacgctgttgctgatcgggcgcgacatgcagccc
ttggccgaggtgcagcagcagctggtcaaggcgcagctggcgctggagcgcgattacgag
gcgcagcgcgagatcgagacccgctatcgcgtgctgctcgaggcgcatccggcgccgctt
ctgatcgtgtcgatgtcgaccgggcggatcgccgatctgaacctggccgcggccgcgatg
atcggcgccacccgggccgagctgatcgacgcgccggtggggcaggagctggacgggcgc
cgccgcggcgaattcctggaaaatctggccaagatcgccgggtcggatccgctgggcgcg
gtcgagctgacgatccgccgctcgcgccgcaaggtgacggtgacggcgacgctgttccgc
gcggcgggcgaccggctgctgttgtgccgtctgggcgaggccgaggcccggcgcacccgt
gtcgatgacacggtcgagctgagcgagcggcttttcctcaagggcatcgatgcgatggtg
tttctggacgccgacggcacgatccgggcggcgaacgacgcctttctgtatctgaccgat
gcgggctcggcggcgctggtgcaggggcggtcctttgccgatttcctgtcgcgcggggcc
gtcgacctcaacgtgcttttggacaacgtcaagcgcatcggccatctgcgccattacgtg
acgcggctgaacaccgatttctcgggtcaggtcacggtcgagctgtcggcgacgctgttc
catgaccgcgcgacgccgacgatcgcgctggtcatccgcgacagcaacctggccgatgcg
acgcggatcatgcccgggatggccagcaacgaggggctgcgcaatgtcatgcagatggtc
ggctatgcgacgctgcgcgacatcgtctcggagaccaccgagatcatcgagaagatgtgc
atcgaaaccgcgctggagctgaccggcaacaaccgggtggccgcggccgagcttttgtcg
ctgtcgcggcaatcgctttatgtgaagctgcgcaagttcggcctgttgtcgaaggacgcg
gaatag

DBGET integrated database retrieval system