KEGG   Rhodobacter capsulatus: RCAP_rcc00670Help
Entry
RCAP_rcc00670     CDS       T01213                                 

Gene name
bchJ
Definition
(GenBank) bacteriochlorophyll 4-vinyl reductase
  KO
K04036  divinyl protochlorophyllide a 8-vinyl-reductase [EC:1.-.-.-]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00860  Porphyrin and chlorophyll metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCAP_rcc00670 (bchJ)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     RCAP_rcc00670 (bchJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: V4R
Motif
Other DBs
NCBI-ProteinID: ADE84435
UniProt: P26169
Position
740021..740662
Genome map
AA seq 213 aa AA seqDB search
MSGAAPAPQDDEPRIGPNAILQTIGVLDRHLGRAERDRVMRLAGVPVPPPDSGMLPESQC
RAVHQALRVDQGEAAEGLLWLSGLATGDYILANRIPGFAKAIIRVLPGFLGARLLAAAIT
KHAWTFVGSGRFRVESFRPLTFRIDDNPLRADAAERPSCFWHAAVFERLFGTLVWPEVTV
EEISCASVSGGPCLFVLHPKGKKTAMPSSVHSG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgccgcgcctgcgccgcaagatgacgagccccggatcgggccgaatgccatc
ttgcaaacgatcggcgtgctcgaccgccaccttggccgtgccgagcgtgaccgggtgatg
cggctggcgggcgtgcccgtcccgccgcctgactcggggatgctgccggaaagccagtgc
cgcgccgtgcatcaggcgctgcgcgtcgatcagggcgaagccgccgagggcctgttgtgg
ctctcggggctggccaccggcgactatatcctggcgaaccggatccccggttttgccaag
gcgatcatccgcgtgctgcccgggtttctgggcgcgcgccttctggcggcggcgatcacc
aaacacgcctggacctttgtgggctccgggcggttccgggtcgaaagcttccgcccgctg
accttccgcatcgatgacaacccgctgcgcgccgacgccgccgaacgcccctcgtgcttc
tggcatgcggcggtgttcgaacggcttttcggcacgcttgtctggcccgaggtgacggtg
gaggaaatctcctgcgcctctgtcagcggggggccgtgcctttttgtcctgcatccgaag
ggcaagaaaacggctatgcccagctctgtccactccggctga

DBGET integrated database retrieval system