KEGG   Rhodobacter capsulatus: RCAP_rcc00677Help
Entry
RCAP_rcc00677     CDS       T01213                                 

Gene name
bchI
Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00860  Porphyrin and chlorophyll metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCAP_rcc00677 (bchI)
Enzymes [BR:rcp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RCAP_rcc00677 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 MCM AAA_22 Sigma54_activat AAA_29 DUF815 AAA AAA_18
Motif
Other DBs
NCBI-ProteinID: ADE84442
UniProt: P26239
Structure
PDB: 

Jmol
Position
complement(747371..748423)
Genome map
AA seq 350 aa AA seqDB search
MTTAVARLQPSASGAKTRPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKST
AVRALAALLPEIEAVEGCPVSSPNVEMIPDWATVLSTNVIRKPTPVVDLPLGVSEDRVVG
ALDIERAISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGENVVERDGL
SIRHPARFVLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKA
FLEEWRPKDMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGELTLLRSARA
LAALEGATAVGRDHLKRVATMALSHRLRRDPLDEAGSTARVARTVEETLP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgccgtcgctcgacttcaaccctctgcttcgggcgcgaagacgagacccgtc
tttcccttttctgccatcgtcggtcaggaagacatgaaactggcgctgctgttgaccgcg
gtcgatcccggcatcggcggcgttctggtctttggtgaccgcggcaccggcaaatcgacc
gcggtgcgggcgctggcggcgcttttgcccgaaatcgaggcggtcgagggctgcccggtg
tcctcgcccaatgtcgagatgatccccgattgggcgaccgtgctttcgaccaacgtgatc
cgcaagccgaccccggtcgtcgatctgccgctcggcgtgtcggaagaccgcgtggtgggg
gcgctggatatcgagcgcgcgatctcgaaaggggaaaaggcgtttgaaccgggccttctg
gcccgggccaaccgcggttacctttacatcgacgaatgcaacctgctggaagatcacatc
gtcgatcttctgctcgacgtggcgcaatcgggcgagaacgtggtggaacgcgacggcctc
tcgatccgtcaccccgcccgtttcgttctggtcggctcgggcaacccggaagagggcgac
ctgcggccgcagcttctggaccgtttcggcctctcggtcgaggttctgtcgccccgcgac
gtcgaaacccgggtcgaggtgatccgtcgccgcgacacctatgacgcagatccgaaagcc
tttctggaagaatggcggcccaaggacatggacatccgcaaccagattctggaagcgcgt
gaacgtctgccgaaggtcgaggcgccgaacaccgcgctttatgactgcgccgcgctttgc
atcgcgctggggtccgacggtctgcggggcgagctgacgcttctgcgatcggcccgtgcc
cttgcggcgctggaaggggcaaccgcggtcggtcgcgatcacctgaagcgggtggcaacg
atggcgctgtcgcaccgtctgcgccgcgatccccttgatgaagccggctcgacggcccgc
gtggcccggacggtcgaagaaacgttgccgtaa

DBGET integrated database retrieval system