KEGG   Rhodobacter capsulatus: RCAP_rcc00677Help
Entry
RCAP_rcc00677     CDS       T01213                                 

Gene name
bchI
Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCAP_rcc00677 (bchI)
Enzymes [BR:rcp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RCAP_rcc00677 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(747371..748423)
Genome map
AA seq 350 aa AA seqDB search
MTTAVARLQPSASGAKTRPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKST
AVRALAALLPEIEAVEGCPVSSPNVEMIPDWATVLSTNVIRKPTPVVDLPLGVSEDRVVG
ALDIERAISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGENVVERDGL
SIRHPARFVLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKA
FLEEWRPKDMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGELTLLRSARA
LAALEGATAVGRDHLKRVATMALSHRLRRDPLDEAGSTARVARTVEETLP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgccgtcgctcgacttcaaccctctgcttcgggcgcgaagacgagacccgtc
tttcccttttctgccatcgtcggtcaggaagacatgaaactggcgctgctgttgaccgcg
gtcgatcccggcatcggcggcgttctggtctttggtgaccgcggcaccggcaaatcgacc
gcggtgcgggcgctggcggcgcttttgcccgaaatcgaggcggtcgagggctgcccggtg
tcctcgcccaatgtcgagatgatccccgattgggcgaccgtgctttcgaccaacgtgatc
cgcaagccgaccccggtcgtcgatctgccgctcggcgtgtcggaagaccgcgtggtgggg
gcgctggatatcgagcgcgcgatctcgaaaggggaaaaggcgtttgaaccgggccttctg
gcccgggccaaccgcggttacctttacatcgacgaatgcaacctgctggaagatcacatc
gtcgatcttctgctcgacgtggcgcaatcgggcgagaacgtggtggaacgcgacggcctc
tcgatccgtcaccccgcccgtttcgttctggtcggctcgggcaacccggaagagggcgac
ctgcggccgcagcttctggaccgtttcggcctctcggtcgaggttctgtcgccccgcgac
gtcgaaacccgggtcgaggtgatccgtcgccgcgacacctatgacgcagatccgaaagcc
tttctggaagaatggcggcccaaggacatggacatccgcaaccagattctggaagcgcgt
gaacgtctgccgaaggtcgaggcgccgaacaccgcgctttatgactgcgccgcgctttgc
atcgcgctggggtccgacggtctgcggggcgagctgacgcttctgcgatcggcccgtgcc
cttgcggcgctggaaggggcaaccgcggtcggtcgcgatcacctgaagcgggtggcaacg
atggcgctgtcgcaccgtctgcgccgcgatccccttgatgaagccggctcgacggcccgc
gtggcccggacggtcgaagaaacgttgccgtaa

DBGET integrated database retrieval system