KEGG   Rhodobacter capsulatus: RCAP_rcc00701Help
Entry
RCAP_rcc00701     CDS       T01213                                 

Gene name
bsaA1
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RCAP_rcc00701 (bsaA1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RCAP_rcc00701 (bsaA1)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RCAP_rcc00701 (bsaA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
770169..770720
Genome map
AA seq 183 aa AA seqDB search
MKLKLMAAAVLTGFGAFAAPAARATEAAAPSFTFASIEGGVIDTAAYRGHPVLVVNTASL
CGFTPQLEGLQALHKAWGPKGLIVLAVPSDDFKQELESGKEVSEFCTLTYGLTVPMTDIT
PVLGEGAHPFFKWLKETQGFVPRWNFNKVLLDGEGRVVATWGSMTKPESSAIRAAFEPLL
PGA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaagctgatggcggccgcggtgctgaccgggttcggggcctttgccgccccc
gccgcccgcgcgaccgaggcggcggcgccgagcttcaccttcgcctcgatcgagggcggg
gtgatcgacaccgccgcctatcgcggtcatccggtgctggtcgtgaacaccgcgtcgctc
tgcggcttcaccccgcagctcgaagggctgcaggcgctgcacaaggcctgggggccgaag
gggctgatcgtgctggccgtgccctcggacgatttcaagcaggagctggagagcggcaag
gaagtctcggaattctgcaccctgacctatggtctgaccgtgccgatgaccgacatcacc
ccggttctgggcgagggcgcgcatccgttcttcaaatggctgaaggagacgcagggcttc
gtgccgcgctggaatttcaacaaggtgcttctggatggcgagggccgggtggtcgccacc
tggggctcgatgacgaagcccgaaagcagcgcgatccgcgccgccttcgagccgcttttg
ccgggggcgtga

DBGET integrated database retrieval system