KEGG   Rhodobacter capsulatus: RCAP_rcc00720Help
Entry
RCAP_rcc00720     CDS       T01213                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase (ADP-forming), beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00020  Citrate cycle (TCA cycle)
rcp00640  Propanoate metabolism
rcp00660  C5-Branched dibasic acid metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01130  Biosynthesis of antibiotics
rcp01200  Carbon metabolism
Module
rcp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rcp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RCAP_rcc00720 (sucC)
   00640 Propanoate metabolism
    RCAP_rcc00720 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RCAP_rcc00720 (sucC)
Enzymes [BR:rcp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RCAP_rcc00720 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A PTE
Motif
Other DBs
NCBI-ProteinID: ADE84485
UniProt: D5APB3
Position
791298..792491
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKQLLKSYGCPVSNGRIVLKADEVKAAASELDGPLWVVKAQIHAGGRGKGHFK
EAEAGEKGGVRLARSVAEAETLARQMLGRTLVTHQTGPAGKQVNRIYIEEGSDISRELYL
ALLIDRKSSRVSFVCSTEGGMDIEEVAAHTPEKILSFSVDPATGLSDFHGRRIAFALGLE
GNQVKQCVSLIKKLYKAFLEKDMEMLEINPLIVTTDGQLKVLDAKLGFDNNALYRQPDVM
DLRDVTEEDPKELEASRFDLNYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTEAFKIITSDPKVKGILVNIFGGIMRCDIIAEGVLAAVKEVGLKVPLVVRLE
GTNVELGKDIIAKSGLNVIAADDLADGAKKIVAAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgaataccaggccaagcagttgctcaagagctacggctgcccggtctcg
aacggccgcatcgtgctcaaggcggacgaggtcaaggctgcagccagcgagcttgacggc
ccgctttgggtggtcaaggcgcagatccacgccgggggccgcggcaagggccatttcaag
gaagccgaagcgggcgaaaagggcggcgtgcgtctggcccgctccgtggccgaggccgaa
acgctggcccgccagatgctgggccgcacccttgtcacccatcagaccggcccggccggg
aaacaggtgaaccgcatctatatcgaggaaggatcggacatctcgcgcgagctctatctt
gcgctgctgatcgaccgcaaatcctcgcgcgtgagcttcgtctgctcgaccgagggcggg
atggacatcgaggaagtcgcggcccacacgccggaaaagatcctctccttctcggttgat
ccggcgacgggtctgagcgatttccacggccgccgcatcgcctttgcgctggggctggag
ggcaatcaggtcaagcaatgcgtgtcgctgatcaagaagctctacaaggccttcctcgag
aaggacatggagatgctggagatcaacccgctgatcgtcaccaccgacggccagctgaag
gtgctcgatgcgaaactcggctttgacaacaacgcgctttaccgccagcccgacgtgatg
gacctgcgcgacgtgaccgaggaagacccgaaggaactggaagcctcgcggttcgacctg
aactacatcgcgctggatggcgagatcggctgcatggtgaacggcgcggggctggcgatg
gccacgatggacatcatcaagctttacggcgccgaaccggccaacttccttgacgtgggc
ggcggcgccaccaaggaaaaggtcaccgaggcgttcaagatcatcacctcggacccgaag
gtgaaggggatcctcgtcaacatcttcggcggcatcatgcgctgcgacatcatcgcggaa
ggcgtgctggcggcggtgaaggaagtgggcctgaaagtgccgctggtggtgcggcttgaa
ggcacgaacgtcgaacttggcaaggacatcatcgccaagtcggggctcaatgtgattgcc
gcggatgatctggccgacggcgcgaaaaagatcgtggcagcggtgaaaggctaa

DBGET integrated database retrieval system