KEGG   Rhodobacter capsulatus: RCAP_rcc00725Help
Entry
RCAP_rcc00725     CDS       T01213                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rcp  Rhodobacter capsulatus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCAP_rcc00725 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RCAP_rcc00725 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RCAP_rcc00725 (sucB)
Enzymes [BR:rcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RCAP_rcc00725 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797416..798969
Genome map
AA seq 517 aa AA seqDB search
MTEIRVPGLGESVSEATVATWFVKPGEMVVADAMLCELETDKVTVEVRAPSAGVLSEIVA
KEGETVAVNALLAVLLSAGAMPPAQPKSEGPAAPQIAAPTVQEVKMTDVMVPALGESVAE
ATVSTWFKKPGDAVAQDEILCELETDKVSVEVPAPAAGVLSEILAPEGASVAAGGRLAIL
AAGSAAAPAPAAAAAAPAPAPAAPAKDVEHAPAAKKAMAEAGLTPDQVTGTGRDGRIMKE
DVAAAAAAPAAAPAPAAPAPVATAQVSIAPPPATVPRAPVPAEDAAREERVKMTRLRATI
ARRLKDAQNTAAMLTTYNEVDMSGVMDLRNVYKDQFEKKHGVKLGFMGFFVKACCHALKE
IPEVNAEIDGGDIIYKNYVHMGVAVGTPSGLVVPVVRDADQKGFAHIEREIAELGKRGRD
GKLTMQEMQGGSFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRPVVVNGQIVIRPMM
YLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLMDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatccgcgttcccgggcttggggaaagcgtctcggaggccaccgtcgccacc
tggttcgtgaaaccgggcgagatggtcgtggccgatgcgatgctttgcgagcttgaaaca
gacaaggtgacggtcgaagtccgcgccccctcagcgggggtgctgagcgagatcgtcgcc
aaggaaggcgagacggtggcggtgaacgccctgctggccgtgcttttgtccgcgggcgcg
atgccgcccgcgcaacccaaatccgaaggcccggcagcccctcaaatcgccgcgccgact
gttcaagaggtcaagatgacggatgtcatggtccccgcgctgggcgaaagcgttgccgaa
gccactgtctccacctggttcaagaagccgggcgatgccgtcgcgcaggacgagatcctg
tgcgagcttgaaaccgacaaggtctcggtcgaggttccggccccggcggcgggcgtgctg
agcgagatcctcgcccccgagggcgcctcggtcgcggcgggcggtcgtctggcgatcctg
gcggcggggtctgccgcggctccagccccggccgctgcggcggccgcccccgcgcccgcc
ccggcggcgcccgcgaaggatgtcgaacatgcccccgcggcgaaaaaggcgatggccgaa
gcgggtctgacccccgatcaggtcaccggcaccggccgcgatggccggatcatgaaggag
gacgtggccgccgccgccgctgccccggccgccgccccggcccctgcggccccggcgccg
gtcgcgacggcgcaggtctcgatcgcgccgccgcccgccaccgtgccgcgcgccccggtc
ccggccgaggatgcggcgcgcgaggaacgggtgaagatgacccgcctgcgcgccaccatc
gcccgccgtctgaaagacgcgcagaacaccgccgcgatgctgaccacctacaacgaggtg
gacatgtcgggcgtgatggacctgcgcaacgtctacaaggaccagttcgaaaagaaacac
ggggtcaagctcggcttcatgggcttcttcgtgaaggcctgctgccacgcgctgaaggaa
atccccgaggtgaacgccgagatcgacggcggcgacatcatctacaagaactacgtccat
atgggcgtggccgtgggcacgccctcgggccttgtggtgccggtggtgcgggacgccgat
cagaagggcttcgcccatatcgagcgcgaaatcgccgaactgggcaagcgcggccgtgac
ggcaagctgacgatgcaggagatgcagggcggcagcttcaccatctcgaacggcggcgtc
tatggctcgctgatgtcgagcccgatcctgaacccgccgcaatcgggcatccttggcatg
cacaagatccaggaccggccggtggtggtgaacggccagatcgtgatccgcccgatgatg
tatctggcgctgagctacgaccaccgcatcgtcgacggcaagggcgcggtgaccttcctt
gtccgggtgaaagaagcgctggaagacccgcgccgcctgctgatggatctctga

DBGET integrated database retrieval system