KEGG   Rhodobacter capsulatus: RCAP_rcc00782Help
Entry
RCAP_rcc00782     CDS       T01213                                 

Gene name
cheR1
Definition
chemotaxis protein methyltransferase CheR (EC:2.1.1.80)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rcp  Rhodobacter capsulatus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rcp02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rcp02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
856156..859221
Genome map
AA seq 1021 aa AA seqDB search
MMDVPAPETDMQGGQGAAASAAPEPRAVVAIGASAGGLDALERLFDGLPADTGAAYVVIQ
HLSPDHKSIMASLLARHTKMPVVTVEDEMELAADTVFLIPPATIMTLEGRHLRLAPKDRR
VLSLPIDAFFTSMAAGFGSRAVAVVLSGTGSDGTRGVGAVHAAGGVAIAQDPRDARFDGM
PRSAIATGFIDSALGIERIGPWIADYLIRRPRLGQLTGAERPDGATGVAVDDDRVAVGQF
DGLEPAEALGRIVEILSLSGEVNFLDYKPGTVQRRIERRMGVRQVPDLTSYLELLTHDRT
ELASLRREMLIPVTSFFRDPDSFAELAEKVIDPLVAQAAVGSTLRVWTAGCATGEEAYTL
AMLFFDAFERAGRWPTLKIFATDVEPMNIETAAAGFFAETIAADLPTTFLERFFTTRGGQ
YTIRPEIRQTIVFARHNLLSDPPFTRMDLVTCRNTLIYFRPEAQERALRRMHYALRTGGY
LFLGGSEALVQVQDDFSVLSARHRIWQALRPGAAPLTDRRAGLYVTPRPPRTRADNAPVT
AVERGFATLSRTYAPPPALLVNSHHEILHSYGEVSRFMQMREGAASLEIGRMLVEPLLPV
ASALLFKSARLGEEAASDSIPIAEGILGPDPMRLRLRVVPVKQGTDSDEGRLYILAFEPD
EGPDDGISGIDIDREVGARIEMLEAELAMTRESLQAMIEELETSNEELQATNEEMMASNE
ELQSANEELQSVNEELNSLNAEYQEKIDLLNRSNADLDSLTEIMAMSTIFVDSELTVTRF
SPDAAELFRIRDVDVGRPLGDLTHRLDYPALLDDLRRTLQGQSRTEREVSGLNGRHYLVR
MLPYRVPSSAAQGAVVTFVDITQTRNLQLLQAVIDGLAEHVAVLDGHGDILLVNAAWTRF
AADNGDPGLAHTGVGTNYVGRCDIGEAAIDSGYAKRAVEGIRSVLTGKQRHFTMEYPCDA
PGQPRWFVMHARPLDGARGGAVVSHIEITRWHNQTEASPETSSGGLPGSDGTGADGGAPR
A
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttcctgcgccagagacggacatgcaaggcgggcagggggccgcggcttcg
gccgcgccggagccccgcgcggtggtggcgatcggcgcctcggccggggggcttgacgcg
ctcgagcggcttttcgacgggctgcccgccgataccggcgcggcctatgtggtgatccag
cacctgtcgcccgaccacaagtcgatcatggcctcgctgctggcgcggcatacgaaaatg
ccggtcgtcaccgtcgaggacgagatggaactggccgccgacacggtgtttctgatcccg
cccgcgacgatcatgacgctggagggacggcatctgcggctggcgcccaaggatcgccgc
gtgctgtccttgccgatcgacgcgtttttcacctcgatggcggcgggctttggcagccgc
gccgtggcggtggtgctgtcgggcaccggctcggacggcacccgcggcgttggcgcggtg
catgcggcgggcggcgtcgccatcgcgcaggatccgcgcgacgcgcgctttgacggcatg
ccgcgttcggccatcgcgacgggcttcatcgattccgcgctgggcatcgagcggatcggc
ccctggatcgctgattacctgatccggcggccgcggctgggccagctcaccggggccgag
cgtcccgatggcgcgacgggcgtggcggtggatgacgaccgcgtcgccgtgggccagttc
gacgggctggaaccggccgaggccctgggccggatcgtcgagatcctgtcgctctcgggc
gaggtgaatttccttgattacaagcccggcacggtgcagcgccggatcgagcggcggatg
ggcgtgcggcaggtgccggacctgacctcctatctggaactgctcacgcatgaccgcacc
gagctggccagcctgcgccgggaaatgctgatcccggtcacctcgttcttccgcgatccg
gactcctttgccgaactggcggaaaaggtgatcgatccgctggtggcgcaggcggcggtg
ggctcgacgctgcgggtctggacggcgggctgcgcgacgggcgaggaagcctatacgctg
gcgatgctgttctttgacgctttcgagcgggcggggcgctggccgacgctgaagatcttt
gccaccgatgtcgagccgatgaacatcgagaccgcggcggccgggttctttgccgaaacc
atcgccgccgatctgccgacgacctttctggaacgcttcttcaccacccgcggcgggcaa
tacacgatccgtcccgagatccggcagaccatcgttttcgcccgccacaacctgttgtcg
gacccgcccttcacccggatggatctggtcacctgccgcaacacgctgatctatttccgc
cccgaggcgcaggaacgcgcgctgcggcggatgcattatgcgctgcgcaccgggggctat
ctgttcctcggcggctccgaggcgctggtgcaggtgcaggacgatttctcggtgctctcg
gcccggcaccggatctggcaggcgctgcgcccgggggccgcgccgctgaccgaccgccgc
gccgggctttacgtcacgccgcgcccgccgcgcacccgcgccgacaatgcccccgtcacc
gcggtcgagcgcggctttgccacgctttcgcgcacctacgcgccgccgcccgcgcttctg
gtcaacagccaccacgagatcctgcattcctacggcgaggtcagccgcttcatgcagatg
cgcgaaggcgccgcctcgctggaaatcggccggatgctggtcgagccgcttctgcccgtc
gcctcggcgcttttgttcaaatcggcgcggctgggcgaggaagccgcctcggattcgatc
ccgatcgccgagggcatcctgggccccgatcccatgcggctgcggctgcgcgtcgtgccg
gtcaagcagggcaccgacagcgacgaggggcggctttacatcctcgccttcgagcccgac
gagggccccgatgacggcatttccggcatcgacatcgaccgcgaggtcggcgcccgcatc
gagatgctggaagccgagctggcgatgacgcgcgaaagcctgcaggcgatgatcgaggag
ctggaaacctcgaacgaggaattgcaggcgacgaacgaggagatgatggcctcgaacgag
gagctgcaatcggccaacgaggaattgcagtcggtcaacgaggaactgaactcgctcaat
gcggaatatcaggaaaagatcgacctgctgaaccgctcgaacgccgatctggacagcctg
accgagatcatggcgatgagcacgatctttgtcgacagcgagctgacggtgacgcggttc
agccccgacgcggcagagctgttccgcatccgcgatgtcgatgtcggccgcccgctgggc
gatctgacgcatcggctggattatccggcgctgctggatgatctgcgccgcacgctgcag
ggccagtcccgcaccgagcgcgaggtctcggggctgaacgggcgacattatctggtgcgg
atgctgccctatcgggtgccgtcctcggcggcgcagggcgcggtggtgacctttgtcgac
atcacccagacccgcaacctgcagctgttgcaggcggtgatcgacgggctggccgaacat
gtggcggtgctggacgggcatggcgacattctgctggtgaacgccgcctggacccggttt
gcggcggataacggcgatccggggctggcccataccggggtcggcacgaattatgtcggc
cgctgcgacatcggcgaggcggcgatcgattccggctatgcgaaacgcgcggtcgagggg
atccgcagcgtcctgaccggcaagcagcggcatttcaccatggaatatccctgcgatgcg
ccggggcagccgcgctggttcgtgatgcatgcgcgcccgctcgatggcgcccgcggcggc
gccgtggtcagccatatcgagatcacccgctggcacaaccagaccgaagccagccccgag
accagttccgggggcctgcccggatctgacgggaccggagccgacgggggggcgccgcgc
gcatga

DBGET integrated database retrieval system