KEGG   Rhodobacter capsulatus: RCAP_rcc00839Help
Entry
RCAP_rcc00839     CDS       T01213                                 

Gene name
glcB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rcp  Rhodobacter capsulatus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCAP_rcc00839 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCAP_rcc00839 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RCAP_rcc00839 (glcB)
Enzymes [BR:rcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RCAP_rcc00839 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(925921..928074)
Genome map
AA seq 717 aa AA seqDB search
MTERVEREGLQVAAELATFIETEALPGTGVDPARFWAGFSALIHAFGPQNRALLDKRDQL
QAQIDAWHLQHRTQGHDATAYRAFLEEIGYLVPEGADFSIETGPTDPEIARVCGPQLVVP
ITNARYALNAANARWGSLYDALYGTDALGTPPAAPGYDPVRGAKVIAWAKDFLDAACPLV
AGSWAQATRLWLQDGGLFAEVAGEETGLRDPAQFAGSRGAPEAPTEILLRNNGLHLILKL
DRGHPIGATDPLGLADLVLESALSSIMDCEDSVATVDAADKVLAYRNWLGLMRGDLTETV
TKGGRSFPRALAPDLTFTAPAGGPVTLKGRALMLVRNVGPLMTTPAILTRSGAEAPEGLM
DAMVTTLCALHDLKRGANSATGSVYVVKPKLHGPEEVAFTCASFAHVEEVLGLPANTVKL
GIMDEERRTSANLKECIRAARDRLAFINSGFLDRTGDEIFTSMEAGPMVTKAEMKSQPWI
SAYEDRNVDIGLRCGLPGKAQIGKGMWAAPDNMAEMLAQKIAHPMAGANCAWVPSPTAAT
LHATHYHRVDVKARQREIAQLQRPLRLFDLLTIPLAVGRTYSEAEITAEIENNAQGILGY
VVRWVDQGIGCSKVPDIHDTGLMEDRATLRISSQALANWLHHGIVGEPQVMKAFRKMAAV
VDRQNAGDPAYQPMAPNFDGLAFQAACDLVFLARIQSSGYTEPVLHQRRAQVKAAKA
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacgcgtggaacgcgaggggctgcaggttgcggccgaactggcgaccttcatc
gaaacggaggcgctgcccggcaccggggtcgatccggcgcgattctgggcggggttttcg
gcgctgatccatgcgttcgggccgcagaaccgggcgctgctggacaagcgcgaccagctg
caggcgcagatcgacgcctggcacctgcaacaccgcacgcagggccatgacgccaccgcc
tatcgcgcctttctggaagagatcggctatctggtgcccgagggcgccgatttcagcatc
gagaccggcccgaccgatcccgagatcgcccgggtctgcggcccgcagctggtcgtgccg
atcaccaatgcgcgctatgcgctcaatgccgcgaatgcgcgctggggcagcctttatgac
gcgctttacggcaccgatgcgctgggaacgccgcccgccgcgcccggctatgacccggtc
cgcggcgccaaggtgatcgcctgggccaaggactttctggatgccgcctgcccgctggtg
gccgggtcctgggcgcaagccacgcggctttggctgcaagacggcggtctgttcgccgaa
gtggcgggcgaagaaaccgggctgagggaccccgcccaattcgcgggcagtcgcggcgcc
cccgaggcgcccaccgaaatccttttgcgcaacaacggcttgcatctgatcctgaagctt
gaccgcggccatccgatcggtgccaccgatccgctggggctggccgatctggtgctcgaa
tcggcgctgtcctcgatcatggattgcgaggattcggtggccaccgtcgatgccgccgac
aaggttctggcctatcgcaactggctgggcctgatgcgcggcgatctgaccgaaacggtg
accaagggcgggcgcagcttcccccgcgcccttgcccccgatctgaccttcaccgcgccc
gcgggtggcccggtcacgctcaagggccgggcgctgatgctcgtgcgcaatgtcgggccc
ctgatgaccacccccgcgatcctgacccgcagcggcgccgaggcgcccgaggggctgatg
gatgcgatggtgaccacgctttgcgcgctccatgacctgaagcgcggcgccaattccgcc
accggctcggtctatgtggtcaagccgaagctgcacggccccgaggaagtcgccttcacc
tgcgccagcttcgcccatgtcgaggaagttctgggcctgcccgccaatacggtgaaactg
ggcatcatggacgaggaacgccgcacctcggccaacctcaaggaatgcatccgcgccgcc
agggatcggctggccttcatcaactcgggctttctggaccggaccggggacgagattttc
acctcgatggaagccgggccgatggtgaccaaggccgagatgaaatcgcagccctggatt
tccgcttacgaggatcgcaacgtcgatatcggcctgcgctgcgggttgccgggcaaggcg
cagatcggcaaggggatgtgggccgcgcccgacaacatggccgagatgctggcgcaaaag
atcgcccatccgatggccggggcgaattgcgcctgggtgccctcgcccaccgccgccacg
ctgcatgcgacgcattaccaccgcgtcgacgtgaaggcgcggcaacgcgagatcgcacag
ctgcaacgaccgctgcggctgtttgatctgctgacgatcccgcttgccgtcgggcgcacc
tattccgaggccgagatcaccgccgaaatcgaaaacaacgcgcaggggattctgggctat
gtggtgcgctgggtcgatcagggcatcggctgttccaaggtgcccgacattcacgacacc
ggcctgatggaagaccgcgcgacgttgcggatcagctctcaggcgctggcgaactggctg
catcacggcatcgtcggcgagccgcaggtgatgaaggccttccgcaagatggcggccgtg
gtcgaccggcagaatgcgggcgatccggcctatcagccgatggccccgaatttcgacggg
ctggcgttccaggccgcctgcgatctggtcttcctcgcccggatccagtcctcgggctat
accgagccggtgctgcaccagcgccgggcgcaggtgaaggccgccaaagcataa

DBGET integrated database retrieval system