KEGG   Rhodobacter capsulatus: RCAP_rcc01132Help
Entry
RCAP_rcc01132     CDS       T01213                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rcp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rcp00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1204138..1205136)
Genome map
AA seq 332 aa AA seqDB search
MTSDIRRFGTTATGQTVEAITLRAGELTARVLTFGATLQDLRLAGTPWPLVLGSDLLAAY
EQRLHWCGAVVGPVANRLWRAQVTLDGRLWQAQPNDGANLLHSGAEGISQRIWTIEEVRA
AAVTLRLDLPDGAAALPGNRVIRASYRLAPPATLEITLAAETDALTLMNLAHHPYWNLDG
TATTAGHRLSVAADHILPTDAENLPLAPVPVETLTLDLRAPRPLPDLPPVDHNFCLSGSG
LRPVAQLTGAKGVHLDLHSDAPGLQIYDGRALQSAPFPGLTGTPYDAHAGVALEPQLWPD
APRHADFPPITLAPGTPWRQRSAVHLTRRPAA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagacatccgccgtttcggcaccaccgccaccggccagacggtcgaggcgatc
acgctgcgcgcgggcgagctgaccgcgcgcgtcctgaccttcggggcgacgctgcaggat
ctgcggctggcgggcacgccctggcctttggtgctgggctcggatcttctggccgcttac
gaacagcgcctgcactggtgcggcgcggtggtcgggccggtggcgaaccggctgtggcgg
gcgcaggtgacgctcgacgggcgcctgtggcaggcgcagcccaatgacggggcgaacctg
ctgcattcgggcgccgaggggatttcgcagcgcatctggacgatcgaggaggtccgcgcc
gcggcggtgaccctgcgtcttgatctgcccgatggcgcggcggcgctgcccggcaaccgg
gtgatccgcgccagctatcggctggcccccccggccacgctggaaatcacgcttgcggcc
gaaaccgatgcgctgacgctgatgaacctggcgcatcacccctattggaacctggacggc
acggcgacgacggcggggcacaggctttcggtcgcggccgatcacatcctgcccaccgat
gccgaaaacctgccgctggccccggtgccggtcgagacgctgacccttgatctgcgcgcc
ccccgaccgctgcccgacctgcccccggtcgatcacaatttctgcctgtcaggcagtggc
ttgcgccccgtggcgcagctgacgggggcaaagggcgtccaccttgatctgcacagcgac
gcgccggggctgcagatctatgacggccgcgcgcttcagtccgcccccttccccgggctg
acgggcacgccctatgacgcccatgccggggtggcgctggagccgcagctttggcccgat
gcgccccgccacgccgatttcccgccgatcacgcttgcgcccggcacgccttggcggcaa
cgtagcgccgtgcacctgacccgccgtcccgccgcttga

DBGET integrated database retrieval system