KEGG   Rhodobacter capsulatus: RCAP_rcc01137Help
Entry
RCAP_rcc01137     CDS       T01213                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCAP_rcc01137 (pfkB)
   01230 Biosynthesis of amino acids
    RCAP_rcc01137 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCAP_rcc01137 (pfkB)
   00030 Pentose phosphate pathway
    RCAP_rcc01137 (pfkB)
   00051 Fructose and mannose metabolism
    RCAP_rcc01137 (pfkB)
   00052 Galactose metabolism
    RCAP_rcc01137 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    RCAP_rcc01137 (pfkB)
Enzymes [BR:rcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RCAP_rcc01137 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1208356..1209303)
Genome map
AA seq 315 aa AA seqDB search
MTAILTVTLNPTVDLSIHADQVAPERKLRCTRPETDPGGGGLNVSRAISALGGHSTAFVA
LGGPTGDKVMHLLAEQGIGLAPFPAPGETRQSLTVTDATTGEQYRFVMPGPTWSASDVTK
VMDRIAKAAPENGIVVLSGSQPPGVPDDFPARLATKIARTRARFFLDTSGKALHQLLTAG
AKPVDVLRMDDLEAEELAGRALPARADSADFAQDLVRRGIARAVVVARGADGNVLATETE
RWVAQAIPDKVVSKVGAGDSFVAAFTLSLGRGLSLPEALRWGAAAAAAAVMTPATDLCTL
ADVKRLLRASSLEKI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgactgccatcctgaccgtcaccctgaaccccaccgtcgatctttcgatccacgccgat
caggtcgcccccgaacgcaagctgcgctgcacccgccccgagaccgatccgggcggcggc
ggtctgaacgtcagccgggcgatctcggccttgggcggccattccaccgccttcgtggcc
cttggcgggcccaccggcgacaaggtcatgcatctgctggccgaacaggggatcggcctt
gcccccttccccgcccccggcgagacgcggcaaagcctgaccgtcaccgatgcgacgacg
ggcgaacaataccgcttcgtcatgcccggcccgacctggtcggccagcgacgtgaccaag
gtgatggaccggatcgcaaaagcggcgcccgaaaacggcatcgtcgtgctctcgggcagc
cagccgccgggcgtgcccgacgactttccggcgcggctggcgacgaaaatcgcccgcacc
cgggcacggttctttctggatacctcgggcaaggcgctgcaccagctgctgaccgccggg
gcgaagcccgtcgacgtgctgcggatggatgatcttgaagccgaggagctggcgggccgc
gccctgcccgcgcgcgccgacagcgccgatttcgcgcaggacctggtccggcgcggcatc
gcccgcgccgtcgtcgtcgcccgcggcgccgatggcaacgtgcttgcgaccgagaccgag
cgctgggtggcgcaggccattcccgacaaggtggtctccaaggtcggcgcgggcgacagt
ttcgtcgccgccttcaccctcagcctcggccgcgggctgagcctgcccgaggcgctgcgc
tggggcgcggcggcggcggcggcggcggtgatgacacccgccaccgacctttgcacgctg
gccgatgtgaaacggctcttgcgcgcctcgtcgctggaaaagatctga

DBGET integrated database retrieval system