KEGG   Rhodobacter capsulatus: RCAP_rcc01141Help
Entry
RCAP_rcc01141     CDS       T01213                                 

Gene name
gltX1
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
rcp  Rhodobacter capsulatus
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCAP_rcc01141 (gltX1)
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    RCAP_rcc01141 (gltX1)
Enzymes [BR:rcp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     RCAP_rcc01141 (gltX1)
Amino acid related enzymes [BR:rcp01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   RCAP_rcc01141 (gltX1)
Transfer RNA biogenesis [BR:rcp03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RCAP_rcc01141 (gltX1)
 Prokaryotic Type
   Other AARSs
    RCAP_rcc01141 (gltX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211208..1212536
Genome map
AA seq 442 aa AA seqDB search
MTVVTRFAPSPTGYIHVGNLRTALMNYLVARKAGGTFILRIDDTDQERSKQEYVDALKAD
LEWLGLTWDREERQSLRFDRYEAAAESLRSVGRFYECFESPTELDLKRKKLLNMHRPPVY
DRAALKLSAEDKARLREEGRDGYWRFLLNQTRIEWHDGIIGDISIDAASVSDPVLIKADG
QVLYTFASSVDDIQMGVTHIVRGADHVTNTATQIQIMEALGGVPPSFAHHSLLTGAKGEE
LSKRLGALSIRDLRANGIAPEALLSLMARLGSSQPVELRMSLDEIAEGFDLSQFGAAPTK
FDPEDLIPLTRARNQHLPFEKVEEEIRKLGIPPHLARDFWAVASKNIDKLSDLAHWAELV
IEGAEAVIDPEDAEFVAAALALLPDLPFAKDTWAVWTAAVKDATGRKGKGLFMPLRKALT
GQAHGPEMADLMPLMQKVRAKA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgttacccgcttcgccccctcgccgaccggctatatccatgtcggcaacctg
cgcaccgccctgatgaactaccttgtcgcccgcaaggccggcggcaccttcatcctgcgc
atcgacgataccgatcaggaacgctcgaagcaggaatatgtggatgcgctgaaggcggat
ctggaatggctcggcctgacctgggaccgcgaggaacgccagtcgctccgctttgaccgt
tacgaggcggcggcggaaagcctgcggtcggtggggcggttctacgaatgtttcgaaagc
ccgacggaactggacctgaagcgcaagaagcttttgaacatgcacaggcccccggtctat
gaccgcgcggcgctgaagctgtcggccgaggacaaggcccggctgcgcgaggagggccgc
gacggctactggcgcttccttttgaaccagacccggatcgaatggcatgacggcatcatc
ggcgacatttcgatcgacgccgcctcggtctcggacccggtcttgatcaaggccgacggg
caggtgctgtacaccttcgcctcgtccgtcgatgacatccagatgggcgtgacccatatc
gtgcgcggcgccgaccatgtgacgaacaccgcgacgcagatccagatcatggaagcgctg
ggcggcgtgccgccgagcttcgcgcaccattcgctgctgaccggcgccaagggcgaggag
ctgtcgaaacggcttggcgcgctctcgatccgcgatctgcgggcgaatggcatcgcgccc
gaggcgcttttgagcctgatggcgcggcttggttccagccagccggtcgagctgcggatg
agccttgacgagatcgccgagggcttcgatctgagccagttcggcgcggcgccgacgaaa
ttcgaccccgaggatctgattccgctgacccgcgcgcgcaaccagcatctgccgttcgaa
aaggtcgaggaggagatccgcaagctgggcattccgccgcatctggcgcgggatttctgg
gccgtcgcctcgaagaacatcgacaagctttccgacctggcgcattgggccgagctggtg
atcgagggcgccgaggcggtgatcgacccggaagacgccgaattcgttgccgcggcgctg
gcgcttttgcccgatctgccctttgccaaggatacctgggccgtctggactgcggcggtg
aaggacgccacgggccgcaagggcaaggggctcttcatgcctttgcgcaaggcgctgacg
gggcaggcgcatgggcccgagatggccgatctgatgccgctgatgcagaaggtgcgcgcc
aaggcgtga

DBGET integrated database retrieval system