KEGG   Rhodobacter capsulatus: RCAP_rcc01141Help
Entry
RCAP_rcc01141     CDS       T01213                                 

Gene name
gltX1
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
rcp  Rhodobacter capsulatus
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rcp00860]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:rcp00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211208..1212536
Genome map
AA seq 442 aa AA seqDB search
MTVVTRFAPSPTGYIHVGNLRTALMNYLVARKAGGTFILRIDDTDQERSKQEYVDALKAD
LEWLGLTWDREERQSLRFDRYEAAAESLRSVGRFYECFESPTELDLKRKKLLNMHRPPVY
DRAALKLSAEDKARLREEGRDGYWRFLLNQTRIEWHDGIIGDISIDAASVSDPVLIKADG
QVLYTFASSVDDIQMGVTHIVRGADHVTNTATQIQIMEALGGVPPSFAHHSLLTGAKGEE
LSKRLGALSIRDLRANGIAPEALLSLMARLGSSQPVELRMSLDEIAEGFDLSQFGAAPTK
FDPEDLIPLTRARNQHLPFEKVEEEIRKLGIPPHLARDFWAVASKNIDKLSDLAHWAELV
IEGAEAVIDPEDAEFVAAALALLPDLPFAKDTWAVWTAAVKDATGRKGKGLFMPLRKALT
GQAHGPEMADLMPLMQKVRAKA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgttacccgcttcgccccctcgccgaccggctatatccatgtcggcaacctg
cgcaccgccctgatgaactaccttgtcgcccgcaaggccggcggcaccttcatcctgcgc
atcgacgataccgatcaggaacgctcgaagcaggaatatgtggatgcgctgaaggcggat
ctggaatggctcggcctgacctgggaccgcgaggaacgccagtcgctccgctttgaccgt
tacgaggcggcggcggaaagcctgcggtcggtggggcggttctacgaatgtttcgaaagc
ccgacggaactggacctgaagcgcaagaagcttttgaacatgcacaggcccccggtctat
gaccgcgcggcgctgaagctgtcggccgaggacaaggcccggctgcgcgaggagggccgc
gacggctactggcgcttccttttgaaccagacccggatcgaatggcatgacggcatcatc
ggcgacatttcgatcgacgccgcctcggtctcggacccggtcttgatcaaggccgacggg
caggtgctgtacaccttcgcctcgtccgtcgatgacatccagatgggcgtgacccatatc
gtgcgcggcgccgaccatgtgacgaacaccgcgacgcagatccagatcatggaagcgctg
ggcggcgtgccgccgagcttcgcgcaccattcgctgctgaccggcgccaagggcgaggag
ctgtcgaaacggcttggcgcgctctcgatccgcgatctgcgggcgaatggcatcgcgccc
gaggcgcttttgagcctgatggcgcggcttggttccagccagccggtcgagctgcggatg
agccttgacgagatcgccgagggcttcgatctgagccagttcggcgcggcgccgacgaaa
ttcgaccccgaggatctgattccgctgacccgcgcgcgcaaccagcatctgccgttcgaa
aaggtcgaggaggagatccgcaagctgggcattccgccgcatctggcgcgggatttctgg
gccgtcgcctcgaagaacatcgacaagctttccgacctggcgcattgggccgagctggtg
atcgagggcgccgaggcggtgatcgacccggaagacgccgaattcgttgccgcggcgctg
gcgcttttgcccgatctgccctttgccaaggatacctgggccgtctggactgcggcggtg
aaggacgccacgggccgcaagggcaaggggctcttcatgcctttgcgcaaggcgctgacg
gggcaggcgcatgggcccgagatggccgatctgatgccgctgatgcagaaggtgcgcgcc
aaggcgtga

DBGET integrated database retrieval system