KEGG   Rhodobacter capsulatus: RCAP_rcc01159Help
Entry
RCAP_rcc01159     CDS       T01213                                 

Gene name
ccoQ
Definition
cbb3-type cytochrome c oxidase subunit IV (EC:1.9.3.1)
Orthology
K00407  
cytochrome c oxidase cbb3-type subunit IV
Organism
rcp  Rhodobacter capsulatus
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome c oxidase, cbb3-type
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rcp00190]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rcp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229044..1229220
Genome map
AA seq 58 aa AA seqDB search
MDYHILREFADSWAALALLLTFIGAVIWAFRPGSSRVHDDIANIPFRHEDKPADRGQG
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atggactatcatatcctgcgtgaattcgccgacagctgggcggcgcttgcgcttttgctc
accttcatcggtgccgttatctgggccttccggcccggatcgtccagggttcacgacgat
atcgcgaacatccctttccgccatgaagacaaacccgccgatcgtggccagggctga

DBGET integrated database retrieval system