KEGG   Rhodobacter capsulatus: RCAP_rcc01176Help
Entry
RCAP_rcc01176     CDS       T01213                                 

Definition
GDSL-like lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rcp  Rhodobacter capsulatus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RCAP_rcc01176
Enzymes [BR:rcp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RCAP_rcc01176
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RCAP_rcc01176
Lipid biosynthesis proteins [BR:rcp01004]
 Fatty acid synthase
  Component type
   RCAP_rcc01176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1246579..1247238)
Genome map
AA seq 219 aa AA seqDB search
MRRRLGKAALAGIFALGIGGGAAAEPVTLLAVGDSLTQGYGLDPDQGLVPQLQGWLRTRG
AEVTVINAGVSGDTTSGGRARLGWSLTPEIDAVMIALGGNDMLRGQPPAQARANLDAMLS
EVTARDLPVALVGLKAPGNYGPDWQAGYDAIWPELGAKYGAVVVPDLLAPIAAKTPEARA
AEGLMQADNIHPSARGVGLVVDALGPKVLELLERVKPAP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcggcggctgggcaaggcggcgcttgcggggattttcgcgctgggcatcggcggg
ggggccgcggccgagccggtgacgcttctggccgtgggcgacagcctgacccaggggtac
gggctggacccggatcaggggctggtgccgcagctgcagggctggttgcggacgcggggc
gccgaggtgacggtgatcaatgcgggcgtgtcgggggacacgacatcgggcgggcgggcg
cggctgggctggtctttgacgcccgagatcgatgcggtgatgatcgcgcttggcggcaat
gacatgctgcgcggccagccccccgcgcaggcgcgcgcgaaccttgatgcgatgctctcc
gaggtgacggcacgggatctgccggtggcgctggtcggtctgaaggcgcccggcaattac
ggcccggactggcaggccggttacgatgcgatctggccggagctgggggcgaaatacggt
gcggtggtggtgcccgatctgctggcgccgatcgccgccaagacgccggaggcgcgcgcg
gccgaggggctgatgcaggccgacaacatccatccctcggccaggggggtggggctggtc
gtcgacgccttggggccgaaagtgctggagctgctggagcgggtgaagcctgcgccctga

DBGET integrated database retrieval system