KEGG   Rhodobacter capsulatus: RCAP_rcc01358Help
Entry
RCAP_rcc01358     CDS       T01213                                 

Gene name
cheB1
Definition
chemotaxis response regulator protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rcp  Rhodobacter capsulatus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rcp02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rcp02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1460196..1461302
Genome map
AA seq 368 aa AA seqDB search
MTVMPDPHSTRRPPGDRPVRVFIVDDSAVVRQALTDIIGSDPRLEVMATASDPFAAAERL
KSMVPDVIILDVEMPRMDGLTFLRKLMAQHPLPVVICSSLVSDRSETYLAAMSAGAVDVI
AKPEIGVKQYISESAQRIRDVLVQAASAKVQPMRERPVQPKLSADAMLAPPRESGAMLRT
TEKIVAIGASTGGTEALRELLQAMPSDCPPIVIVQHMPELFTGAFAKRLDGLCAITVSEA
KPGDRLLRGHALIAPGNKHTLLARSGAQYHVEVRDGPLVSRHRPSVDVLFRSVARFAGRN
AVGVIMTGMGDDGARGLREMRDTGATTLGQDEESCVVYGMPKEAMARGAVGQEMSLGQLP
AAILRASR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgatgcccgatccgcattccacccgccgcccgccgggcgaccgcccggtccgg
gtcttcatcgtcgatgacagcgcggtggtgcggcaagccctgaccgacatcatcggctcc
gatccgcggctcgaggtgatggcgaccgcctccgatccctttgccgcggccgaacggctg
aaatccatggtgcccgatgtcatcatcctggatgtcgagatgccgcggatggacgggctg
accttcctgcgcaagctgatggcgcagcatccgctgccggtggtgatctgctcctcgctc
gtctccgaccggtccgagacctatctggccgcgatgtcggcgggggcggtcgacgtgatc
gccaagcccgagatcggggtgaagcagtatatttccgaaagcgcgcagcggattcgcgac
gttctggtgcaggcggcttcggccaaggtgcagccgatgcgcgaacggccggtgcagccc
aagctcagcgccgatgcgatgctggcgccgccgcgcgaaagcggcgcgatgctgcgcacg
accgaaaagatcgtggcgatcggtgcctcgaccggcggcaccgaggctttgcgcgaattg
ctgcaggcgatgccgtccgactgcccgccgatcgtgatcgtgcagcacatgccggaactc
ttcaccggggctttcgccaagcgccttgacgggctttgcgcgatcacggtgagcgaagcg
aaaccgggcgaccggctcttgcgcggccatgcgctgatcgcaccgggcaacaagcacacg
cttctggcccgcagcggcgcgcaatatcatgtcgaggtccgcgacggcccgctggtgtcg
cgccaccgcccctcggtcgatgtgctgttccgctcggtcgcgcggtttgccgggcgcaat
gcggtgggcgtgatcatgaccggcatgggcgacgacggcgcccgcggcttgcgcgagatg
cgcgacaccggcgccaccacgctgggccaggacgaggaaagctgcgtcgtctacggcatg
ccgaaagaggcgatggcgcgcggcgccgtgggccaggaaatgtcgcttggccagctgccc
gcggcgatcctgcgcgcctctcgttga

DBGET integrated database retrieval system