KEGG   Rhodobacter capsulatus: RCAP_rcc01406Help
Entry
RCAP_rcc01406     CDS       T01213                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rcp  Rhodobacter capsulatus
Brite
Enzymes [BR:rcp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     RCAP_rcc01406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1519774..1520343)
Genome map
AA seq 189 aa AA seqDB search
MHMTNRGLLALARHEGIVPGPYLDVRKIWTFGIGHTAAAGPPDPAQMPRGLPADVTAAIR
DAFRLFRTDITTYEAAVSRAVQVPLAPHEFDALVSFHYNTGGIAKAALTRHLNAGNRRAA
ADAFMGWLRPAGIRPRREAERDLFRDGRYPTGALTVWPVDRNGRVDFARPLRRLSEADTL
ALLSQPNTL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgaccaaccgggggcttctggccctcgcccggcacgagggcatcgtgcccggg
ccctatcttgacgtccgcaagatctggaccttcggcatcggccacaccgccgcggcgggc
ccgcccgaccccgcacagatgccgcgcggtctgcctgcggatgtcaccgccgcgatccga
gacgccttccgccttttccgcaccgacatcacaacctacgaggccgcggtctcgcgcgcg
gtgcaggtaccgcttgccccacacgaattcgatgcgctggtcagcttccactacaacacc
ggcggcatcgccaaggcggccctcacccgccatttgaatgcaggcaaccgccgcgctgcg
gccgatgccttcatgggctggctgcgccccgccgggatccggccccggcgcgaggccgaa
cgcgatctcttccgcgacggccgctatcccaccggcgcgctcaccgtctggccggtcgat
cgcaacggccgggtggatttcgcccgcccgctgcggcggctgagcgaggcggacaccctc
gcgctgctctctcagcccaacacactctga

DBGET integrated database retrieval system