KEGG   Rhodobacter capsulatus: RCAP_rcc01598Help
Entry
RCAP_rcc01598     CDS       T01213                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCAP_rcc01598 (tpiA)
   01230 Biosynthesis of amino acids
    RCAP_rcc01598 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCAP_rcc01598 (tpiA)
   00051 Fructose and mannose metabolism
    RCAP_rcc01598 (tpiA)
   00562 Inositol phosphate metabolism
    RCAP_rcc01598 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RCAP_rcc01598 (tpiA)
Enzymes [BR:rcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RCAP_rcc01598 (tpiA)
Exosome [BR:rcp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RCAP_rcc01598 (tpiA)
  Exosomal proteins of bladder cancer cells
   RCAP_rcc01598 (tpiA)
  Exosomal proteins of melanoma cells
   RCAP_rcc01598 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1729779..1730522)
Genome map
AA seq 247 aa AA seqDB search
MRRKLAAGNWKMNGTKASLAEVAALIAAHPDPKSEVLLCPPATLVAAMVATAAGRIAVGG
QDCHMKAAGAHTGDIAAEMLADCGASHVILGHSERRADHGESSEMVCAKATAARAAGLVA
VICVGETEAQRDAGETLALVGAQLAGSVPDGATAANTVIAYEPVWAIGTGRTPTLEQIAE
VHDFLRAELVARFGAEGEGMRLLYGGSVKPSNATEIFATSNVDGALVGGASLKAADFGAI
LSALDAA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaaattggccgcgggcaactggaagatgaacggcaccaaggcaagcttggcc
gaagtggcggcgctgatcgcggcgcatcccgatccgaaatccgaagttctgctgtgcccg
cccgcgacgctggtcgcggcgatggtggcgacggcggcgggcaggatcgcggtcggcggg
caggattgccacatgaaggccgcgggcgcgcataccggtgacatcgcggccgaaatgctg
gccgattgcggcgcctcccatgtgatcctcggccattccgaacgccgcgccgatcatggc
gaaagctcggagatggtttgcgccaaggccaccgctgcccgcgccgcgggtctggtcgcg
gtgatctgcgttggcgagaccgaagcgcagcgcgatgcgggcgagacgctggcactggtc
ggcgcgcagctggcgggctcggttccggacggcgccaccgcggcgaatactgtcatcgcc
tacgaacccgtctgggcgatcggcaccggccgcacgccgacgctggaacagatcgccgaa
gtgcatgatttcctgcgcgcggaactggtcgcgcgcttcggcgccgagggcgaaggcatg
cggcttctttacggcggctcggtgaaaccctcgaacgcgaccgagatctttgccacctcg
aatgtcgatggcgcgctggtgggcggcgcttcgctcaaggccgccgatttcggcgcgatc
ctgagcgcgctcgacgcggcctga

DBGET integrated database retrieval system