KEGG   Rhodobacter capsulatus: RCAP_rcc01598Help
Entry
RCAP_rcc01598     CDS       T01213                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00010  Glycolysis / Gluconeogenesis
rcp00051  Fructose and mannose metabolism
rcp00562  Inositol phosphate metabolism
rcp00710  Carbon fixation in photosynthetic organisms
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01130  Biosynthesis of antibiotics
rcp01200  Carbon metabolism
rcp01230  Biosynthesis of amino acids
Module
rcp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rcp_M00002  Glycolysis, core module involving three-carbon compounds
rcp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCAP_rcc01598 (tpiA)
   00051 Fructose and mannose metabolism
    RCAP_rcc01598 (tpiA)
   00562 Inositol phosphate metabolism
    RCAP_rcc01598 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RCAP_rcc01598 (tpiA)
Enzymes [BR:rcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RCAP_rcc01598 (tpiA)
Exosome [BR:rcp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RCAP_rcc01598 (tpiA)
  Exosomal proteins of bladder cancer cells
   RCAP_rcc01598 (tpiA)
  Exosomal proteins of melanoma cells
   RCAP_rcc01598 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADE85343
UniProt: D5ATQ4
Position
complement(1729779..1730522)
Genome map
AA seq 247 aa AA seqDB search
MRRKLAAGNWKMNGTKASLAEVAALIAAHPDPKSEVLLCPPATLVAAMVATAAGRIAVGG
QDCHMKAAGAHTGDIAAEMLADCGASHVILGHSERRADHGESSEMVCAKATAARAAGLVA
VICVGETEAQRDAGETLALVGAQLAGSVPDGATAANTVIAYEPVWAIGTGRTPTLEQIAE
VHDFLRAELVARFGAEGEGMRLLYGGSVKPSNATEIFATSNVDGALVGGASLKAADFGAI
LSALDAA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaaattggccgcgggcaactggaagatgaacggcaccaaggcaagcttggcc
gaagtggcggcgctgatcgcggcgcatcccgatccgaaatccgaagttctgctgtgcccg
cccgcgacgctggtcgcggcgatggtggcgacggcggcgggcaggatcgcggtcggcggg
caggattgccacatgaaggccgcgggcgcgcataccggtgacatcgcggccgaaatgctg
gccgattgcggcgcctcccatgtgatcctcggccattccgaacgccgcgccgatcatggc
gaaagctcggagatggtttgcgccaaggccaccgctgcccgcgccgcgggtctggtcgcg
gtgatctgcgttggcgagaccgaagcgcagcgcgatgcgggcgagacgctggcactggtc
ggcgcgcagctggcgggctcggttccggacggcgccaccgcggcgaatactgtcatcgcc
tacgaacccgtctgggcgatcggcaccggccgcacgccgacgctggaacagatcgccgaa
gtgcatgatttcctgcgcgcggaactggtcgcgcgcttcggcgccgagggcgaaggcatg
cggcttctttacggcggctcggtgaaaccctcgaacgcgaccgagatctttgccacctcg
aatgtcgatggcgcgctggtgggcggcgcttcgctcaaggccgccgatttcggcgcgatc
ctgagcgcgctcgacgcggcctga

DBGET integrated database retrieval system