KEGG   Rhodobacter capsulatus: RCAP_rcc01703Help
Entry
RCAP_rcc01703     CDS       T01213                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00010  Glycolysis / Gluconeogenesis
rcp00020  Citrate cycle (TCA cycle)
rcp00620  Pyruvate metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01130  Biosynthesis of antibiotics
rcp01200  Carbon metabolism
Module
rcp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCAP_rcc01703 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RCAP_rcc01703 (pdhC)
   00620 Pyruvate metabolism
    RCAP_rcc01703 (pdhC)
Enzymes [BR:rcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RCAP_rcc01703 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ADE85448
UniProt: D5AU09
Position
complement(1835612..1836868)
Genome map
AA seq 418 aa AA seqDB search
MAVEILMPALSPTMEEGTLAKWLVKEGDAVKSGQIIAEIETDKATMEFEAVDEGVIGKLL
VAEGTSGVKVNAAIAVLIEEGGSAEVAPVAKAAAPAPVAAPAVATPAAPVVPKAAGARIF
ASPLARRIAADKGLDLAAISGSGPHGRIVKADVEGAVAKPAPAAAPVLVAAPAPAPVSAA
TVAKLYEGRAYTEIPLDGMRRVIAARLTEAKQTIPHFYLRREVRLDALLSFREELNRQLS
ARGVKLSVNDFIIKASALALQAIPAANAVWAGDRVLQMQASDVAVAVAIEGGLFTPVLQD
ADTKSLSQLSAQMKDLAKRARDRKLAPHEYQGGSFAISNLGMMGIESFDAVINPPHGAIL
AVGAGVKKPVVSASGTIEVATMMALTLSVDHRVIDGALGAELLAAIVSNLENPMAMLA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggaaatcctgatgcccgctttgtcccccacgatggaggagggcacgctggca
aaatggctggtcaaggaaggcgatgcggtcaaatcgggccagatcatcgccgagatcgag
accgacaaggcgacgatggaattcgaggcggtcgatgaaggcgtgatcggcaagcttctg
gtggccgagggcacttcgggggtgaaggtgaatgccgccatcgccgtgctgatcgaagag
ggcggcagcgccgaggttgcgccggtggcgaaggccgcggcccctgccccggtcgcagcg
cctgcggtggcgacgcccgcggcgccggtcgtgccgaaagcggcgggcgcgcggatcttc
gcctcgcccttggcgcggcggattgcggccgacaaggggctggatctggcggcgatttcg
gggtccggcccgcatgggcggatcgtcaaggccgatgtcgaaggcgcggtggcgaaaccc
gcgcctgcggcggctccggtccttgtggcggcccctgctccggcacccgtctcggctgcg
acggtcgcgaagctttatgagggccgggcctataccgagatcccgctcgatggcatgcgt
cgggtgattgcggcgcggctgaccgaggcgaagcagacgatcccgcatttctacctgcgc
cgcgaggtgcgtctggatgcgcttttgtccttccgcgaggagctgaaccggcagctttcg
gcgcgcggcgtcaagctttcggtgaatgatttcatcatcaaggccagtgccctggcgctg
caggcgattccggcggcgaatgcagtctgggcgggggatcgggtgctgcagatgcaggcc
tcggacgtggccgtggccgtggcgatcgagggcgggcttttcacccccgtgctgcaggat
gccgatacgaaatcgctgagccagctgtcggcgcagatgaaggatctggccaagcgcgcg
cgggaccggaaactcgccccgcacgaatatcagggcgggtcgtttgcgatctcgaacctg
gggatgatggggatcgaaagcttcgacgcggtgatcaacccgccgcatggcgcgattctg
gccgtgggcgcgggggtgaagaaacccgtggtgagcgcttcgggcacgatcgaggtggcc
acgatgatggcgctgacgctctcggtcgatcaccgggtgatcgacggcgcgctgggggcc
gagcttctggccgcgatcgtgtccaatctggaaaacccgatggcgatgctggcctga

DBGET integrated database retrieval system