KEGG   Rhodobacter capsulatus: RCAP_rcc01723Help
Entry
RCAP_rcc01723     CDS       T01213                                 

Gene name
ccpA
Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rcp  Rhodobacter capsulatus
Brite
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RCAP_rcc01723 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1855800..1856849)
Genome map
AA seq 349 aa AA seqDB search
MKRTQISLLAVATLLAAPALAEDAALREEAKGLFEVIPMQAPQLADNNTVTRDKIDLGAM
LFFDPRMSKSGVFSCQSCHNVGLGGVDGLETSIGHGWQKGPRNAPTALNAVFNVAQFWDG
RAPDLAAQAKGPVQAGVEMNNTPENLVATVQSMPGYVEAFAKAFPGQKDPISFDNFALAV
EAFEATLITPNSKFDQWLMGADGAMSADEKAGLKLFIDTGCAACHNGINIGGNGYYPFGV
VEKPGAEVLPAGDKGRFAVTATADDEYVFRAGPLRNIALTAPYFHSGKVWDLREAVSVMA
NSQLGATLDDTQVDQITAFLGTLTGEQPEVVHPILPVRSAQTPRPEHMN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcactcagatcagcctgttggccgtggccacgctgcttgccgcccccgccctt
gccgaggatgccgcgctgcgcgaagaggccaagggcctctttgaagtgatcccgatgcag
gcgccgcagctggccgacaacaacaccgtcacccgcgacaagatcgatctgggggcgatg
ctgttctttgatccgcggatgtcgaaatcgggcgtgttctcgtgtcagtcctgccacaac
gtcgggcttggcggggtggacgggctggaaacctcgatcgggcacggctggcagaagggg
ccgcgcaatgcgcccaccgcgctgaacgccgtcttcaacgtggcacaattctgggacggc
cgcgccccggatctggcggcgcaggccaagggtccggtgcaggcgggcgtcgagatgaac
aacacccccgaaaatctggtggcgacggtgcaatcgatgccgggctatgtcgaggccttc
gccaaggccttcccggggcagaaggacccgatcagcttcgacaatttcgcgctggcggtc
gaggccttcgaggccacgctgatcacgccgaattcgaaattcgaccaatggctgatgggc
gccgatggcgcgatgagcgcggatgaaaaggccgggctgaagctgttcatcgacaccggc
tgcgcggcttgccacaacggtatcaacatcggcggcaacggctattaccccttcggcgtg
gtggaaaaacccggcgccgaggtgctgcccgcgggcgacaagggccgctttgcggtcacc
gcgacggcggatgacgaatatgtcttccgcgccgggcccttgcgcaacatcgcgctgacc
gcgccctatttccactccggcaaggtctgggatctgcgcgaggcggtgtcggtgatggcg
aattcgcagctgggcgcgacgcttgacgacacgcaggtcgatcagatcaccgccttcctt
ggcacgctgaccggcgagcagcccgaggtggtgcatccgatcctgccggtgcgcagcgcc
cagacgccccggcccgagcacatgaactga

DBGET integrated database retrieval system