KEGG   Rhodobacter capsulatus: RCAP_rcc01724Help
Entry
RCAP_rcc01724     CDS       T01213                                 

Gene name
speB1
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rcp  Rhodobacter capsulatus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RCAP_rcc01724 (speB1)
Enzymes [BR:rcp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RCAP_rcc01724 (speB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1857018..1857995
Genome map
AA seq 325 aa AA seqDB search
MALEDAKNQIDMAFTREDPRGLAFENAFAGATSFLRRRYTKDLTGIDLAVTGVPFDQAVT
HRPGTRFGPRAIREASTLQAFDAPYGWGFDPFSELAIADYGDLAFDYAHTASFPDRVTDH
IAGILAQGAGVITLGGDHFITLPILRAFAAHHGPVALVHFDAHSDSWADDDMSRIDHGTF
LYKALKLGFVAPETTVSVGIRTDNPDTCGVTILDAPFVHQAGVAETVARIRAVAGDRPTY
ISFDIDGLDPAFAPGTGTPVWGGLASWQAAAILRGLAGINLVGGDVVEVSPPYDPTGATA
IAGAHVATELIALYGFTRRKGANAS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcactggaagacgcgaaaaatcagatagatatggccttcacgcgggaagatccgcgc
ggtctggccttcgagaacgcctttgcgggcgcgacctcgtttctgcggcggcgctacacc
aaggacctgaccggcatcgatcttgcagtgaccggggtgcccttcgaccaggccgtcacc
catcggccgggcacccgcttcgggccgcgggccatccgcgaagcctcgacgctgcaggcc
ttcgacgcgccctatggctggggcttcgatccgttcagcgagctggcgatagccgattac
ggcgatctggccttcgactatgcccatacggccagctttcccgaccgggtgaccgatcac
atcgcaggcattctggcgcagggcgcgggggtgatcacgctggggggcgatcacttcatc
accctgccgatcctgcgcgcctttgccgcccatcacggccccgtcgcgctggtccatttc
gacgcccattccgacagctgggctgatgacgacatgagccggatcgaccacggcaccttc
ctgtacaaggcgctgaaactgggcttcgtcgcccccgagaccacggtttccgtcggcatc
cgcaccgacaaccccgacacctgcggcgtgaccattctggatgcgcccttcgtgcatcag
gcgggcgtcgccgaaaccgtggcgcggatccgcgcggtggcgggcgaccggccgacctac
atcagcttcgacatcgacggcctcgatccggcctttgccccgggcacgggcacgccggtc
tggggcggtctggccagctggcaggcggcggcgatcctgcgcgggctggccgggatcaat
ctggtcggcggcgatgtcgtcgaggtctcgccgccctatgaccccaccggcgccaccgcg
attgcgggcgcccatgtcgccacggagttgatcgcgctttacggtttcacacgccgcaag
ggcgccaacgcatcgtga

DBGET integrated database retrieval system