KEGG   Rhodobacter capsulatus: RCAP_rcc01768Help
Entry
RCAP_rcc01768     CDS       T01213                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00010  Glycolysis / Gluconeogenesis
rcp00052  Galactose metabolism
rcp00500  Starch and sucrose metabolism
rcp00520  Amino sugar and nucleotide sugar metabolism
rcp00521  Streptomycin biosynthesis
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01130  Biosynthesis of antibiotics
rcp01200  Carbon metabolism
Module
rcp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rcp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCAP_rcc01768 (glk)
   00052 Galactose metabolism
    RCAP_rcc01768 (glk)
   00500 Starch and sucrose metabolism
    RCAP_rcc01768 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RCAP_rcc01768 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RCAP_rcc01768 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RCAP_rcc01768 (glk)
Enzymes [BR:rcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RCAP_rcc01768 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADE85513
UniProt: D5AU74
Position
complement(1911472..1912449)
Genome map
AA seq 325 aa AA seqDB search
MITATPNRYALLADIGGTNTRVALSEHGRLLPESIRRYANAGQPALEPILAAYMQTEGVS
DLAGACVAAAGPVRDGTAHMTNLSWVIESAAIARVTGAETVAVLNDLQAQGHALGHLAPD
AVATVLPGQPARPGSAQLVIGVGTGFNAAPVHEAPGGRIVTASECGHITLPTVTDEDIRL
MRFVEAAHGFAAVEDVLSGRGLERVFAFAAAEAGQPHSRTAAEVMAEITARSPLGLETAR
IFVRHLGAVVGDLALIHLPFGGIHLCGGVARAFTPLLAEFGLAAAMQAKGRFSDFLAAFP
LRVIEDDYAALVGCAAHLHALAPRI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgccaccccgaaccgttatgcgcttctggccgatatcggcggcaccaacacc
cgggtggcgctctccgagcacgggcggctcctgcccgaatcgatccgccgctatgccaat
gcgggccaacccgcgctggagccgatcctggccgcctatatgcagaccgagggcgtctcc
gatctggcaggcgcctgcgtcgccgccgccggtccggtccgcgatggcacggcgcatatg
accaatctgtcctgggtgatcgaaagcgccgccatcgcccgtgtcaccggggccgagacg
gtcgccgtgctgaacgatctgcaggcgcagggccatgcgctgggccatctcgccccggac
gcggtggcgaccgtgctgcccggtcagcccgcgcggcccggctcggcgcagcttgtcatc
ggcgtcggcaccggcttcaacgccgcccccgtgcacgaggccccgggcggacgcatcgtc
accgcctcggaatgcggccacatcaccttgcccacggtgacggacgaagacatccgcctg
atgcgctttgtcgaggcggcgcatggttttgctgcggtcgaggacgtgctctcgggccgc
ggtctggaacgcgtcttcgccttcgccgccgccgaggccgggcagccgcacagccgcacc
gccgccgaggtgatggccgagatcaccgcccgcagcccgcttggccttgaaaccgcgcgc
atcttcgtgcgccatctgggcgcggtcgtgggcgatctggcgctgatccacctgcccttc
ggcggcatccatctgtgcggcggcgtcgcccgcgccttcaccccgctgctcgccgagttc
ggactcgccgccgcgatgcaggccaagggccggttttccgactttctcgccgctttcccg
ctgcgggtgatcgaggatgattacgccgcgcttgtcggttgtgccgcccatctgcacgcg
ctcgcgccgcggatctga

DBGET integrated database retrieval system