KEGG   Rhodobacter capsulatus: RCAP_rcc01768Help
Entry
RCAP_rcc01768     CDS       T01213                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCAP_rcc01768 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCAP_rcc01768 (glk)
   00052 Galactose metabolism
    RCAP_rcc01768 (glk)
   00500 Starch and sucrose metabolism
    RCAP_rcc01768 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RCAP_rcc01768 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RCAP_rcc01768 (glk)
   00524 Butirosin and neomycin biosynthesis
    RCAP_rcc01768 (glk)
Enzymes [BR:rcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RCAP_rcc01768 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1911472..1912449)
Genome map
AA seq 325 aa AA seqDB search
MITATPNRYALLADIGGTNTRVALSEHGRLLPESIRRYANAGQPALEPILAAYMQTEGVS
DLAGACVAAAGPVRDGTAHMTNLSWVIESAAIARVTGAETVAVLNDLQAQGHALGHLAPD
AVATVLPGQPARPGSAQLVIGVGTGFNAAPVHEAPGGRIVTASECGHITLPTVTDEDIRL
MRFVEAAHGFAAVEDVLSGRGLERVFAFAAAEAGQPHSRTAAEVMAEITARSPLGLETAR
IFVRHLGAVVGDLALIHLPFGGIHLCGGVARAFTPLLAEFGLAAAMQAKGRFSDFLAAFP
LRVIEDDYAALVGCAAHLHALAPRI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgccaccccgaaccgttatgcgcttctggccgatatcggcggcaccaacacc
cgggtggcgctctccgagcacgggcggctcctgcccgaatcgatccgccgctatgccaat
gcgggccaacccgcgctggagccgatcctggccgcctatatgcagaccgagggcgtctcc
gatctggcaggcgcctgcgtcgccgccgccggtccggtccgcgatggcacggcgcatatg
accaatctgtcctgggtgatcgaaagcgccgccatcgcccgtgtcaccggggccgagacg
gtcgccgtgctgaacgatctgcaggcgcagggccatgcgctgggccatctcgccccggac
gcggtggcgaccgtgctgcccggtcagcccgcgcggcccggctcggcgcagcttgtcatc
ggcgtcggcaccggcttcaacgccgcccccgtgcacgaggccccgggcggacgcatcgtc
accgcctcggaatgcggccacatcaccttgcccacggtgacggacgaagacatccgcctg
atgcgctttgtcgaggcggcgcatggttttgctgcggtcgaggacgtgctctcgggccgc
ggtctggaacgcgtcttcgccttcgccgccgccgaggccgggcagccgcacagccgcacc
gccgccgaggtgatggccgagatcaccgcccgcagcccgcttggccttgaaaccgcgcgc
atcttcgtgcgccatctgggcgcggtcgtgggcgatctggcgctgatccacctgcccttc
ggcggcatccatctgtgcggcggcgtcgcccgcgccttcaccccgctgctcgccgagttc
ggactcgccgccgcgatgcaggccaagggccggttttccgactttctcgccgctttcccg
ctgcgggtgatcgaggatgattacgccgcgcttgtcggttgtgccgcccatctgcacgcg
ctcgcgccgcggatctga

DBGET integrated database retrieval system