KEGG   Rhodobacter capsulatus: RCAP_rcc02538Help
Entry
RCAP_rcc02538     CDS       T01213                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase, beta-2 subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00260  Glycine, serine and threonine metabolism
rcp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01130  Biosynthesis of antibiotics
rcp01230  Biosynthesis of amino acids
Module
rcp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCAP_rcc02538 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCAP_rcc02538 (trpB2)
Enzymes [BR:rcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCAP_rcc02538 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADE86268
UniProt: D5AMJ2
Position
complement(2727188..2728396)
Genome map
AA seq 402 aa AA seqDB search
MTSYLKTTPDKDGWFGSYGGAMLPPPLEPHFKEIREAYAKISKSADFIAELRLIRKHFQG
RPTPVSYLKNLSALCGGAQIYAKREDLNHTGAHKLNHCMAEGLLAKFMGKTKLMAETGAG
QHGVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLLGATVVPVSFGGRSLKEAVDSC
FQSYIAQADTALFAIGSVVGPHPFPRMVRDFQHVIGVEAREQFLEMTGELPDMVAACVGG
GSNAMGIFSGFIDDASVGLYGVEPLGTSSNLGDHAATISFGEDGDIHGFRTLVLKDANGE
PAPVHTVASGLDYPGVGPEHAHLHKIGRVHYTTADDKEALKAFYALSRHEGIIPALESAH
AVAFAMREAAANPGRSILINLSGRGDKDIDYVTQTYGFGTDL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctatctcaagacgacaccggacaaggacggctggtttggcagctacggcggg
gcgatgctgccgccgccgctcgagccgcatttcaaggagatccgcgaggcttatgcgaag
atctcgaaatcggccgatttcatcgccgagctgcggctgatccgcaagcatttccagggc
cggcccacgcccgtttcctatctgaagaacctctcggcgctgtgcggcggcgcacagatc
tatgccaagcgcgaggatctcaaccataccggcgcgcataagctcaaccattgcatggcc
gagggcctgctggcgaaattcatgggcaagaccaagctcatggccgaaaccggggcgggg
cagcacggggtggcgctggccacggcggcggcctatttcggcatggaatgcgaaatccac
atgggcgagatcgacatcgccaaggaagcgccgaacgtcacccggatgaagcttttgggc
gcgacggtggtgccggtctcctttggcgggcgctcgctgaaggaggcggtggacagctgc
ttccaaagctacatcgcccaggccgataccgcgcttttcgccatcggctcggtcgtcggc
ccgcatcccttcccgcggatggtgcgcgatttccagcatgtcatcggcgtggaagcgcgg
gagcaattccttgaaatgacgggcgaattgcccgacatggtggcggcttgcgtcggcggc
ggctcgaatgcgatggggatcttctcgggcttcatcgacgatgcttcggtcggtctttac
ggggtcgagccgctcggcacctcctccaatctcggcgatcacgcggcgacgatttccttt
ggcgaggatggcgacatccacggcttccgcacccttgtgctgaaggacgccaacggcgag
cccgcgccggtgcacaccgtcgcctcggggctggattatcccggcgtcggcccggaacat
gcgcatctgcacaagatcggccgggtgcattacaccaccgccgatgacaaggaggcgctg
aaggccttttacgcgctgtcgcggcacgaggggatcattcccgcgctggaaagcgcgcat
gccgtggcctttgcgatgcgcgaggcggcggccaatccgggccggtcgatcctgatcaac
ctgtcgggccggggcgacaaggacatcgactacgtcacccagacctacggcttcggcacc
gatctgtaa

DBGET integrated database retrieval system