KEGG   Rhodobacter capsulatus: RCAP_rcc02620Help
Entry
RCAP_rcc02620     CDS       T01213                                 

Gene name
acsA2
Definition
(GenBank) acetate--CoA ligase-2
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00010  Glycolysis / Gluconeogenesis
rcp00620  Pyruvate metabolism
rcp00640  Propanoate metabolism
rcp00680  Methane metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01130  Biosynthesis of antibiotics
rcp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCAP_rcc02620 (acsA2)
   00620 Pyruvate metabolism
    RCAP_rcc02620 (acsA2)
   00640 Propanoate metabolism
    RCAP_rcc02620 (acsA2)
  Energy metabolism
   00680 Methane metabolism
    RCAP_rcc02620 (acsA2)
Enzymes [BR:rcp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RCAP_rcc02620 (acsA2)
Lipid biosynthesis proteins [BR:rcp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RCAP_rcc02620 (acsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADE86350
UniProt: D5AN60
Position
complement(2808599..2810569)
Genome map
AA seq 656 aa AA seqDB search
MGKQEQVVAAPEMREVPAGFETAHANGAKYLEMYRESLENPDAFWGREGKRLDWITPYTK
VKNTDFTFGKVSIKWFEDGVLNASVNCIDRHLRDRALQTAIIFEPDDPKEPARHITYKEL
SEKVNRMANVLLSQGIMRGDRVVIYLPMIPEAAYAMLACARIGAIHSIVFAGFSPDALAN
RINDCGAKLVITADTAPRGGRRTPLKANTDAALLHCSDKVRCLVVKHTGDQISWVHGRDV
DLLYLMEHVSPECPPRPMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAAMTHQYTFDY
KDGDVFWCTADVGWVTGPSYIIYGPLANGATTLMFEGVPTWPDAGRFWAVCEKHKVNQFY
TAPTAIRALMGQGPEWVEKYDLSSLRVLGSVGEPINPEAWVWYDKYVGKGKCPIVDTFWQ
TETGGHMITPLPGATPTKPGSATNPFFGVKPVVLDPQTAVRIGEVECEGVLCISDSWPGQ
MRTVWGDHDRFQETYFGQYRGYYFTGDGCRRDKDGYYWITGRVDDVINVSGHRMGTAEVE
SALVAHPQVAEAAVVGYPHDIKGQGIYAYVTLMNGIEPSEDLRKDLVKWVRTEIGPIASP
DLIQWAPGLPKTRSGKIMRRILRKIAENDYGALGDISTLADPGVVQELIDNRMNRA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcaggaacaggtggtcgcagcgcccgagatgcgggaggttccggcggggttt
gagactgcgcatgcgaatggcgcgaaatatctcgagatgtatcgggaatcgctcgagaat
ccggatgcgttctgggggcgcgagggcaagcggctcgactggatcacgccctataccaag
gtgaagaataccgatttcaccttcggcaaggtctcgatcaaatggttcgaggatggggtg
ctgaacgcgtccgtgaactgcatcgaccggcatctgcgcgaccgcgcgctgcagaccgcg
atcatcttcgagcccgatgacccgaaggaaccggcgcgtcacatcacctacaaggagctc
tccgaaaaggtgaaccggatggcgaacgtgctgctcagccagggcatcatgcgcggcgac
cgggtggtgatctatctgccgatgatccccgaggcggcctatgcgatgctcgcctgcgcc
cggatcggggccatccattccattgttttcgcaggcttttcgcccgatgcgctggcgaac
cggatcaatgattgcggcgccaaactggtgatcaccgccgataccgcgccgcggggtggc
cgccgcacgccgctgaaggcgaataccgatgccgcccttctgcactgctcggacaaggtg
cgctgccttgtcgtcaagcacaccggcgatcagatcagctgggtgcatggccgcgatgtc
gaccttttgtacctgatggagcacgtcagcccggaatgcccgccccgcccgatgaatgcg
gaagatccgctcttcatcctctacacctcgggctcgaccggcaaacccaaaggcgtcgtg
catacgacgggcggctacctcgtctatgccgcgatgacgcaccaatacacgtttgattac
aaggacggcgacgtgttctggtgcaccgccgatgtgggctgggtgacgggtcccagctac
atcatctacgggcccttggcgaacggcgcgacgacgctgatgttcgagggcgtgccgacc
tggcccgatgcggggcggttctgggcggtgtgcgaaaagcacaaggtcaatcagttctac
accgcgccgacggcgatccgcgcgctgatgggtcagggcccggaatgggttgagaaatat
gacctttcctcgcttcgggtgctgggctcggtgggcgagccgatcaaccccgaggcctgg
gtctggtacgacaaatatgtcggaaaagggaaatgtccgatcgtcgacaccttctggcag
accgagaccggcgggcacatgatcacgcccttgcccggcgcgacaccgacgaaaccgggc
tcggcgacgaacccgttctttggcgtcaagccggtggtgctggacccgcagaccgcggtg
cggatcggcgaggtcgaatgcgagggggtgctctgcatttccgacagctggcccgggcag
atgcggacggtctggggcgatcacgaccgcttccaggagacctatttcggccagtatcgc
ggctattacttcaccggcgacggctgtcggcgcgacaaggacggctattactggatcacc
ggccgggtcgatgacgtgatcaacgtctcggggcaccggatgggcacggccgaggtggaa
tcggcgctcgtcgcgcatccgcaggtggccgaggcggcggtggtgggctatccgcatgac
atcaagggccagggcatctacgcctatgtgaccctgatgaacgggatcgagccttccgag
gatctgcgcaaggatctggtgaaatgggtccgcaccgagatcggcccgatcgcctcgccc
gatctgatccaatgggcgccgggcctgccgaagacgcgctcgggcaagatcatgcgccgg
atcctgcgcaagatcgccgagaacgactatggcgcgcttggcgacatctcgacgctggcc
gatccgggcgtggtgcaggagctgatcgacaaccggatgaaccgggcctga

DBGET integrated database retrieval system