KEGG   Rhodobacter capsulatus: RCAP_rcc02653Help
Entry
RCAP_rcc02653     CDS       T01213                                 

Gene name
glpK1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rcp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2842780..2844243)
Genome map
AA seq 487 aa AA seqDB search
MSALRVLAIDQGTTNTKALVVAGDGSVLARAAAPLVTQYPQSGWAEQSAEALWASVQQVI
AQALQAAPGPVDAIAIANQRETLVLWDAVTHQPLCPAMIWQCRRTAEDCAALAATGIGPV
VAAATGLGLNPLFPASKLAWALRNIPAVAAAQDSGRLRAGTVDAWLLWNLTGGAVHATDH
SNAARTLLFDTASLSFSPELAAIFAVPMACLPQPLPSDSLFGTTAAGVTALPAGVSIHAM
MGDSHAALYGHGVRAPGAVKATYGTGSSLMTLTPARVTSRHGLSGTIGWTDRQGTAYALE
GNITVSAQAAAFMAKLLGLADARALSDLAQTVPDAGGVSFVPALAGLGAPHWNDAARGTL
TGMSHATGPAHLARAALDAIAHQIADVFEAMQADIGHPLAALSADGGASGNDFLMQLQAD
LIGRPVQVAALEEVGAMGVAAMAMAALGHRLPLAAPKPPFHPGLRPAERDRQRRAWAHAV
AQAALPG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctgcgggttctggccatcgatcagggcacgacgaacaccaaggctctggtg
gtcgcgggcgacgggtcggtgctggcccgcgccgcggccccgctggtgacgcagtacccg
caatccggctgggcggaacaatcggccgaggccctctgggcctcggtgcagcaggtgatc
gcgcaggcgttgcaggcggcgcccggcccggtcgatgccatcgccatcgccaaccagcgc
gagacgctggtgctgtgggatgcggtcacccatcagccgctctgcccggcgatgatctgg
caatgccggcgcacggccgaggattgcgcggcgctggcggcgaccggcatcggcccggtg
gtcgcggcggcgacggggcttggtctcaacccgctgtttccggcctcgaaactggcctgg
gctttgcgcaacatccccgccgtggcggccgcgcaggacagcgggcggctgcgggcgggc
acggtcgatgcctggcttttgtggaacctgaccggcggcgcggtgcatgcgaccgatcat
tcgaacgccgcgcgcacgcttttgttcgacaccgcaagcctgagcttctcgcccgagctt
gccgcgatctttgccgtgccgatggcctgcctgccgcagcccttgccctcggacagcctg
ttcggcacgacggccgcgggggtgacggcgctgcctgcgggcgtgtccattcacgcgatg
atgggcgacagccatgccgcgctttacggccatggcgtgcgcgcgcccggtgcggtcaag
gcgacctatggcacgggctcctcgctgatgacgctgacgccggcgcgcgtgacgtcacgc
cacgggctttcggggacgatcggctggacggaccggcagggcacggcctatgcgctggaa
ggcaatatcaccgtctccgcgcaggcggcggccttcatggcgaaactgctggggctcgcg
gatgcccgggcgctctcggatctggcgcagaccgtgcccgatgcgggcggcgtgagcttc
gttccggcgctggcggggcttggcgcgccgcattggaacgacgcggcccgcggcacgctg
accggcatgagccatgccaccggccccgcccatctggcgcgggcggcgcttgacgccatc
gcgcatcagatcgccgatgtcttcgaggcgatgcaggccgatatcggccatccgctggcg
gcgctttcggccgatggcggcgcttcgggcaatgatttcctgatgcagctgcaggccgat
ctgatcggccgtccggtgcaggtcgcggcgctggaagaggtgggggcgatgggcgtggcc
gcgatggcgatggcggcccttggccaccggctgccgctcgccgcgccgaaaccgccgttc
caccccggcctgcgaccggccgagcgcgaccggcaacgccgcgcctgggcccatgccgtc
gcccaggccgcgctgcccggctga

DBGET integrated database retrieval system